KEGG   Atta cephalotes (leaf cutting ant): 105625901Help
Entry
105625901         CDS       T04923                                 

Definition
(RefSeq) equilibrative nucleoside transporter 1
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acep02000]
    105625901
Transporters [BR:acep02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   105625901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 105625901
NCBI-ProteinID: XP_012062601
UniProt: A0A158NYJ3
Position
Unknown
AA seq 471 aa AA seqDB search
MSYSINRRPLLGGATDSEFEDDLETEVDDPNITIPDEKPFFKSYEPHDKYNLAYIVFYLL
GINTLIPWSFFITADDYWMYKFREIHNNSTNLTHTYAELLEQKTDLQASFTSYLSVASAI
PNTLFLILNAFISKKVSLTIRMVGSQCAILLLFILTTAFVEMNTDKWQNAFLIITLTTVA
LVNAASAIFGGSLMGIVGKFSPKYITAMSGGQALGGIFTALAEVCSLWIGASPVLSGLVY
FIIGDTMLLLSLIAYILLEKAPFFKHHMIEKVPELDSDYSINREVSFSTNPSVSYTRIIK
RIWHYGISIFLIFFISLAVYPAVTVLVESEYKGKGHAWNDIYFVPVVTYLIFSTGDYAGR
VLCGILQWPRGKPWLVIFLSVARGIFIPALMFCNAQPRHHLPVYIHSDIYYILITIAFAV
TNGYLCNLTFILAPTIVDNQEKEIASAMMGAFLGIGLASGAALSLYMVKAL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcatactctatcaatagaagacccttattgggaggtgcgactgacagcgaatttgag
gacgatttggagactgaagtggatgatcctaacatcacaattccagacgagaaaccattt
tttaaatcatatgagccacatgacaaatataatcttgcgtacattgtgttttacttactt
ggtataaatacattaataccatggagtttttttatcactgctgacgactactggatgtat
aaatttagagaaattcataataattcgacaaatcttactcatacgtatgcagaactactc
gaacagaagacggatcttcaagctagttttacttcttatttaagtgtagccagtgcaata
ccaaatactctgtttttaatactgaatgcatttattagcaagaaagtctctctaactata
agaatggtgggttctcaatgtgcaatattgttgctcttcatcttgacgactgcatttgtg
gaaatgaatactgataaatggcaaaatgcatttctgataattactttgacaacagttgcg
cttgtaaatgctgcgagtgcaatttttggaggaagtttaatgggtatagtgggcaagttt
tcgccaaaatacataactgctatgtccggtgggcaagctcttggtggaatattcacggct
ctagcggaagtgtgttccttatggataggtgccagtccagtactttctggcttagtatac
ttcattatcggcgataccatgttattattatcgttaatcgcatacatccttttagagaaa
gcgccattcttcaagcatcatatgatagaaaaagtacctgaattagattcagattattcc
ataaatagagaggttagcttctcgacaaatccgagcgtgtcttacacacggattataaag
agaatctggcattacggcattagcatatttttaatattcttcatatcactagctgtgtat
ccagccgtcactgtgctagtagagagtgaatacaaaggcaaaggtcatgcatggaacgac
atatattttgtacctgtggttacgtaccttatcttcagtacaggcgattatgcaggaaga
gtattatgtggtattcttcaatggccaagaggcaagccatggctcgtaatatttttgagc
gtcgctagaggtatttttatacctgcacttatgttttgcaatgcgcaaccgaggcatcat
ctacccgtttatattcacagtgatatatattatatcttgataactattgcatttgccgta
actaatggctatctctgtaatttaacattcattctcgcgcccacaatcgtagataatcag
gaaaaagaaattgcgtctgcaatgatgggtgctttcttgggtataggattagcatctggc
gctgcgctcagtttatacatggtgaaggctctttaa

DBGET integrated database retrieval system