KEGG   Atta cephalotes (leaf cutting ant): 105626166Help
Entry
105626166         CDS       T04923                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00480  Glutathione metabolism
acep00590  Arachidonic acid metabolism
acep00980  Metabolism of xenobiotics by cytochrome P450
acep00982  Drug metabolism - cytochrome P450
acep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105626166
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105626166
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105626166
   00982 Drug metabolism - cytochrome P450
    105626166
Enzymes [BR:acep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105626166
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     105626166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_N_4 GST_C Tom37 GST_N_2
Motif
Other DBs
NCBI-GeneID: 105626166
NCBI-ProteinID: XP_012062868
UniProt: A0A158NZB0
Position
Unknown
AA seq 211 aa AA seqDB search
MSMYKLTYFKDGAVGEPSRYLLSYCGIKFEDVRLTMEEWPKHKSNMPMGQLPILEIDNKT
YHQSRAIARFIAKKGNLYGSDEFEAMEIDATVDSMEDIRRVMGEYYWEQNPVFKAKLKET
ALQKLPFYLDKFEAQVKNNDGYFINGKVMIDYMSNYRLSWPDFMWAAYSERISFILTRDV
NQDHPELKKLVEKIRALSKIKAYIEKRSKIQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgtacaagttaacgtactttaaggatggtgccgttggggaaccatccagatat
ttattaagttattgcggcattaaatttgaagatgttagactcactatggaagaatggccg
aagcataaatcaaacatgcccatgggacaactgccgattttggagatagacaataagaca
taccatcaatccagagctatcgctcgctttattgctaagaagggtaatttatacgggtct
gacgagttcgaggctatggagattgatgctacagtcgattctatggaggatataagacga
gttatgggcgaatactattgggaacagaatcctgttttcaaagcaaagttaaaggaaacc
gccttgcaaaaattgcctttctatctcgataaattcgaagctcaagttaagaataatgat
ggatatttcatcaatggcaaagtaatgatcgattacatgtcgaactataggctgtcatgg
ccggatttcatgtgggctgcatattctgaacgtataagctttatcttaaccagggatgtg
aatcaggatcatccagagttgaagaagctagtggagaagattcgcgccttatccaagatt
aaagcttacatcgagaagcgatccaaaattcaatag

DBGET integrated database retrieval system