KEGG   Atta cephalotes (leaf cutting ant): 105626336Help
Entry
105626336         CDS       T04923                                 

Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105626336
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acep03032]
    105626336
   03036 Chromosome and associated proteins [BR:acep03036]
    105626336
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acep04147]
    105626336
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     105626336
    2.7.11.23  [RNA-polymerase]-subunit kinase
     105626336
Protein kinases [BR:acep01001]
 Serine/threonine kinases: CMGC group
  CDK family
   105626336
DNA replication proteins [BR:acep03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    105626336
Chromosome and associated proteins [BR:acep03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105626336
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105626336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 105626336
NCBI-ProteinID: XP_012063027
UniProt: A0A158NZR9
Position
Unknown
AA seq 297 aa AA seqDB search
MDNFIKIEKIGEGTYGVVYKGKHKRTGEIVAMKKIRLENDDEGIPSTAIREISLLKELTH
PNIVSLIDVLMEESKLYLIFEYLTMDLKKYMDSLDNKLMDSTVVKSYLYQITRAILFCHK
RRILHRDLKPQNLLIDKTGIIKVADFGLGRAFGIPVRIYTHEVVTLWYRAPEILLGATRY
SCAIDMWSIGCIFAEMATNKPLFQGDSEIDQLFRIFRILRTPTEEIWPGVTQLPDYKTTF
PNWMTNNLDLQVKTLEPDGLNLLEAMLTYDPVYRISARAALQHPYFNDLDTCKIPAV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggataatttcataaaaatagaaaaaatcggagaaggtacttatggagtagtatacaaa
ggaaaacataaaagaactggagaaattgtagccatgaaaaagattcgcttagaaaatgat
gacgagggaataccatcaaccgctattagagaaatttcattgcttaaagaattaactcat
ccgaacatagtgagcttgatcgatgtattaatggaagagtcaaaactatatcttattttt
gaatatctcactatggacctaaaaaaatacatggatagtttggataataaactgatggac
tcaactgtagttaaatcgtatttgtatcagatcacacgtgcaattttgttctgtcacaag
cgtagaatattgcatcgtgatttaaaaccacagaatttgctaattgataagactggaatt
attaaagtagcagatttcggacttggaagagcattcggaatcccagtgagaatatataca
cacgaagttgtaactctgtggtacagggcgcctgagattctcctcggtgctactagatat
tcgtgtgcgattgatatgtggagtattggatgtatttttgctgaaatggcaactaataaa
ccattgtttcagggagacagcgaaattgatcaacttttcaggatattccgaatactaaga
acgcctacggaagaaatatggccaggtgtaacgcaattgccagattacaaaacgacattc
ccaaattggatgacgaataacttggacttgcaagtaaagacgttggagcctgatggtttg
aatctattggaagctatgctcacgtacgatcctgtatatagaatatccgcacgagcagca
ttgcaacatccctattttaatgatttagatacatgcaaaatacccgctgtataa

DBGET integrated database retrieval system