KEGG   Atta cephalotes (leaf cutting ant): 105626368Help
Entry
105626368         CDS       T04923                                 

Definition
(RefSeq) rho-associated protein kinase 2
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:acep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    105626368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acep01001]
    105626368
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acep03036]
    105626368
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105626368
Protein kinases [BR:acep01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   105626368
Chromosome and associated proteins [BR:acep03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105626368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Pkinase_C Seadorna_VP7 APH DUF4806 DUF2318
Motif
Other DBs
NCBI-GeneID: 105626368
NCBI-ProteinID: XP_012063059
UniProt: A0A158NZV1
Position
Unknown
AA seq 1371 aa AA seqDB search
MDAVCDEDRRRRLRALEENIKDPRSVTNIDCLLDTVQALVTDCDHASVKRMKNIEAYMNR
YDSVAQEIFKMRMRMDDFTLIKVIGRGAFGEVQLVRHKSTQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAHANSPWIVQLHFAFQDQKYLYMVMDYMPGGDLVNLMSNYEVPEKWAKFY
CAEVVLALDAIHNMGFVHRDVKPDNMLLDRHGHLKLADFGTCMRMDVDGLVRSDTAVGTP
DYISPEVLQSQGGEGVYGRECDWWSVGVFLYEMLFGDTPFFADSLVGTYSKIMDHRNSLY
FPQNVEISHSAKNLICGFLTDRTKRLGRNGVDEIKSHPFFKNDQWTFDNLRECVPPVVPE
LSGDDDTSNFDDVDKEDGPEESFPVPKAFSGNHLPFIGFTYSGDYQLMVSYGKESVDGLE
NHVNNGTTDDIKISQLENLLERERRQVETMESRQKALNTQLETMACREVELREEVSRADK
ELTLLRHNYKEAQRRVEHETETRRKAESLLVEVKKKFDEEQTRRARDASNSQQTSERVTT
LEKQIKEMQCKLERETETVTRLRKQATEITVARQAAEQMANELQVARAQLQAQRDNLQQE
VATLQGQLSKERSSRSQASLLTAELETRLSTLHLELERSHEKEEKATLDNRQLTERVSAL
EKEAASLTLELKAAQARYNQEVVAHQETERSRILSKEEANLEVVKALQVKLNEEKSGRQR
AELLAQEKERQTSMLSVDYRQIQQRLQKLEGEHRQEMEKAKVLQGQVEQEQQKRNVLQTE
LSQQTSEAGRLRAREQQLVGEVAQLREAKRQIEEELHHLKTQRNVDQLQTKELQEQLEAE
AYFSTLYKTQTQELREELDEKIRLQQELEEERSSLVHQLQLSLARGDSEALARSIAEETV
ADLEKERTMKELEYKDGVTKHHQELSTKEQIINRLKENESEFKKSVDQTLKEKEDLSKRY
KELQEQLGKAQSNVEEIEKLSSKLKTEQLLKQQAVNKLAEIMNRKDLSSSGKNKNKASAA
DLRKKEKDCRRLQQELTQEREKYGQLAAKWQKDLQDLQAQLVEENQAKLRLQMELDSKDS
EIETLQMKIASLNSETASVSSIENDDGEDSVLSEHGTMRLEGWLNVPNKQNIKRHGWKKQ
YVVVSSKKIIFYNSENDKMNADPVLILDLNKVFHVRSVTQGDVIRANAKDIPRIFQLLYA
GEGEARRPGDEGNTLPGVDLPQLTDKPGTQSLKGHEFVSISYHMPTTCEVCSKQLWHMFR
PSPALECRRCRIKVHKEHLDKKEDAIAPCKLHYDPNSARELLLLAANPEDQKYWVSRLSR
RVQKCGYKANSHMDGTGQRVSPRESTRSTLKPYLSVQQRSATLPANASMGK
NT seq 4116 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggtgtgcgatgaggacaggcggagacgcctacgggctttggaggagaatata
aaggatcctagaagcgtcacgaatatcgactgcttgttggacacggttcaagccctggta
acagattgcgatcatgccagcgtgaaacgtatgaagaatatagaagcttatatgaataga
tatgactctgtagcccaagagatttttaaaatgcgaatgcgcatggacgattttactttg
ataaaagtaatcggccgtggcgcgttcggagaggtgcagttggttagacacaagtctaca
caaaaagtttatgctatgaaattacttagtaaatttgaaatgattaaaaggtcggattcc
gcatttttttgggaagaaagagacataatggctcacgcaaattcaccatggatagtccag
ctccactttgcgttccaagatcaaaagtatctctacatggtgatggattacatgccgggc
ggggatctggttaacttgatgtcgaattatgaagtgccagagaaatgggcaaaattttac
tgtgccgaagtagtgctcgcattggacgcgatacataatatgggtttcgttcatagagac
gtgaaaccggacaacatgttactcgatagacatggccatttgaaacttgccgactttggc
acgtgtatgaggatggatgttgatggtttagtgcgatctgacactgcggttggtacaccc
gattacatatctccggaggttctacagtcacaaggtggagaaggagtatatggtcgcgaa
tgcgactggtggtccgtgggtgtctttttgtatgagatgttatttggcgatacaccattc
tttgccgattctctagttggcacatattctaagatcatggaccacaggaattcgctgtac
ttccctcaaaatgttgagatatctcactcagcgaaaaacttaatatgtggcttccttacc
gatagaacaaagcgcctgggtcgcaatggcgttgacgaaatcaaaagtcatccatttttc
aagaatgatcaatggacctttgacaatttgagggaatgcgtaccgccagtagtgccagaa
ctttccggggacgatgataccagcaattttgatgatgtcgacaaggaagatggaccagag
gagagttttccagtacctaaagctttttccggaaatcatttgccttttatcggatttact
tactcgggtgattatcaactaatggtttcttacggcaaggaatccgtggatggtcttgag
aatcatgtcaacaatggtactaccgacgatatcaagatttcgcagctagagaatttactg
gaacgtgagaggcggcaagtggagacgatggagtcgagacagaaggcattaaacacgcaa
ttggaaacgatggcatgtcgagaggttgagctgcgcgaggaagttagcagggcagataag
gagttgacgctactcaggcacaactataaagaggcgcaacgtagagtagagcatgaaaca
gagactcgtcgtaaagcggagtcactgttggtagaggtaaagaagaaattcgatgaggaa
cagacgagacgggcgcgtgatgctagcaattcacagcagacatccgagcgagtgacgacg
ttggaaaaacagatcaaagagatgcaatgcaaattggagagagaaacggaaacggttacg
agattgcgcaaacaagcgacagaaatcaccgtggcgcgtcaagccgccgagcaaatggcg
aacgagttgcaagttgcccgagctcagttgcaagcgcagcgtgataacttgcaacaagaa
gttgctactcttcagggccagctttccaaggaacgtagttcgagatcgcaagcgtcatta
ttgacggccgaattagagactcgtctttccactttacatctcgagttagaacgcagccat
gagaaagaggagaaggcgactctggacaacagacaactaactgaaagagtttctgcgttg
gagaaagaagctgctagcttaacattggaactgaaagccgcgcaagctagatataatcag
gaagttgtggcacatcaagaaacggagcgttcgcgcattctttccaaggaagaagccaat
ctggaagttgtgaaagctctacaagtaaaattaaacgaggagaaaagtggaagacaacgt
gcggaattacttgcgcaagaaaaggaacggcagacatcaatgctgtctgtcgattataga
cagatacagcaacgattgcagaaattagagggtgaacacaggcaagagatggagaaagcc
aaagttctgcaaggccaagttgaacaggagcaacagaaaagaaacgttctgcaaactgaa
ttaagccagcaaacttctgaagccggcagacttcgtgctcgcgagcaacaattagttgga
gaggttgctcagttgagggaagctaagcggcaaatagaagaggagttacatcatttgaag
acacaaagaaacgtcgatcaattacaaacaaaggaactacaagaacaattggaagctgaa
gcttatttctcgactctatacaaaacacagacacaagagttgcgcgaagagttggatgag
aaaataagattgcaacaagaattagaagaagaacgtagctctcttgtccatcagctacag
ttatccttggcgcgcggtgacagcgaagctctggccagatccatagccgaggaaactgtg
gcggatttagagaaagaaagaaccatgaaagagctagagtataaagacggagtaactaag
catcatcaggaattaagcacaaaggaacagatcataaatagacttaaagagaacgagagt
gaattcaagaaatcagttgatcaaactctgaaggaaaaagaagacttgagtaagcgatat
aaggaattgcaagaacaacttggtaaagcacagtctaacgtggaggaaattgaaaagcta
agcagcaagttgaagaccgagcaactattgaagcagcaggcagttaacaagttagccgag
atcatgaatcgaaaggatctttcgtcaagtggaaagaataagaataaagcgtctgccgca
gatctgagaaagaaggaaaaagattgcaggcgtttgcagcaagaactcactcaagagaga
gagaagtatggacaactggcagctaaatggcaaaaggatttacaagatttgcaagcgcaa
ttagtagaagagaatcaagcaaagctgaggttgcaaatggaactcgactcgaaagactcg
gagatagaaacactacaaatgaaaatcgcgtcactcaactcggaaactgcaagtgtctca
tctatagagaatgacgacggtgaagactctgtcctatctgagcacggtacgatgagattg
gagggttggttaaatgtgccaaataagcaaaacattaagcggcacggttggaagaagcaa
tacgttgttgtttcttccaagaagataattttctacaacagcgaaaatgataaaatgaat
gcagatccggtcctgatattagacttgaataaagttttccatgttagatctgttactcaa
ggtgatgttatccgagccaatgccaaagatatacccagaatatttcagttactttacgct
ggtgaaggtgaagcaaggcggcccggtgacgaggggaatacactgcctggagtggattta
ccacagctcacagataaacctggtactcagtcgctgaaaggccatgagttcgtgtcaata
tcttatcacatgccaacgacttgcgaagtctgttcaaagcaactgtggcatatgtttcgg
ccttcgccggccctcgaatgccgaagatgccgtattaaagttcacaaggaacatttggat
aagaaagaagatgccatagccccgtgcaaactacactacgatccgaacagcgcccgcgag
ctattgctgctcgccgctaatcctgaggatcaaaagtattgggtctcgcggctgtccagg
cgcgtccagaaatgcggctacaaggcgaattcgcacatggacggcacgggacagcgcgtc
tcgccaagggaatccacaaggtcgaccttgaagccgtacttatcggtgcaacaacgatct
gcaacattgccagcgaacgccagcatgggcaagtga

DBGET integrated database retrieval system