KEGG   Atta cephalotes (leaf cutting ant): 105627044Help
Entry
105627044         CDS       T04923                                 

Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00600  Sphingolipid metabolism
acep01100  Metabolic pathways
Module
acep_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105627044
Enzymes [BR:acep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     105627044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat QLQ
Motif
Other DBs
NCBI-GeneID: 105627044
NCBI-ProteinID: XP_012063713
UniProt: A0A158P1Q5
Position
Unknown
AA seq 650 aa AA seqDB search
MVERKHWPMEDSVQGTSSAVLEEIFYVTSKRNTYYKVKLTEKGLSLQKEHNGATKIETIA
LGDIIGCRCMRSKRRNTGSCACRPGASKSQMKLVESAELYQQCDELDMSAYLYIYAYTLK
KTRMKVTLRRERTTITLRFRSFDKYEDNLREASRWRLAIKCLVANVPVPKNLMSPSHGNL
ETLVGACPGENRKLLVLVNPKSGPGRGRDTFQKRIHPILSEAERSYEIHVTKCSNYAREF
VRTRDIYQWSGLLMVGGDGIVFEVVNGIFQRPDWEKALRELPLGVIPCGSGNGLAKSIAH
AKKEPYDRNPLLISALSAVKCKKTSMDIVRVETRNQILFSFLSVGWGLLADIDIESERLR
AIGGQRFTVWSVARLIGLRTYKGKVSYLPCNKVPTTENMENGNIYHKDYIAENILSHSRS
YGDELDRCCAKPESEPKDFYNTFGESSNDLNGYDDNDMITENLALETENERRHRLDSFYS
ATSAKSTYFSTGSASSYHSMEDDNSTEIDAENICNNQVMYGPSSTLPALTSQFSNCWTTI
QGEFIMVHAAYQTHLGQDYFFAPRAALADGIIWLLIAKAGISRANLVQFLLGLSSGTHVT
CPGVDMIPVKAFRIEPMEGTSGHITVDGEEVDYGPLQAEIFSSLASVMTP
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggtggaacgcaagcattggcccatggaggatagcgtacaaggaacctcgagcgccgtc
ctcgaggagattttctacgtgacgtcgaaacggaatacgtattacaaggtgaagctgacg
gagaagggtctgagcttgcaaaaggagcacaatggcgcgacaaagatcgagacgatcgcc
ttaggtgacatcatcggttgcagatgcatgcggtcgaagcgcagaaacacgggcagctgc
gcctgccgaccgggcgcgtccaagtcgcagatgaagctagtggagtcggccgagctctac
cagcagtgcgatgagctcgacatgtcggcgtacctctacatatatgcgtacacgttgaag
aaaacgcgcatgaaggtcacgttgaggcgcgaacgtacaacaattactttgcgtttccgc
agcttcgacaagtatgaggataatctgcgggaggccagcaggtggcgattggcaatcaag
tgcctggtcgccaacgtgccggtgccgaaaaatcttatgagtcccagccacggcaatttg
gagacgttggtcggggcgtgtccaggtgagaatcggaaacttctggtgttggtgaacccg
aaatcaggacctggcagaggcagagataccttccagaagaggatccatccaatcttgtcg
gaagcggagagatcttacgagattcacgttaccaagtgttctaattacgctcgtgaattc
gtgcgcacaagagatatttatcagtggagcggtctgttgatggttggtggcgatggaatc
gtcttcgaggtagtgaacggaatcttccaaaggcccgattgggagaaagctctgcgcgaa
ttgccgcttggggtgataccatgcggctccggcaatggtttggcgaagtctattgctcac
gctaagaaagaaccgtacgatcgcaatcctttgcttatcagcgcattatcggcggtcaaa
tgtaaaaagacatcgatggatattgtacgcgtagaaactagaaatcaaattcttttctca
tttctgtcggtgggctggggtctattggctgatattgacatcgaaagtgaacgacttcgc
gccatcggaggtcaaagatttaccgtatggagcgtagcgcgtctaataggattgagaaca
tataaaggtaaagtgtcgtatttaccttgcaacaaggttcccacgacagaaaatatggaa
aacggcaatatatatcacaaggactatatcgcggagaatatattgtcgcattcgagaagc
tacggcgacgaattggacaggtgttgtgccaaacctgaatcagaaccgaaagatttctac
aatactttcggtgaatcatccaacgatttgaacggttacgatgataacgacatgataact
gagaacctagctctcgagacggaaaacgagaggagacatagacttgacagcttctactcc
gcaacctcagcaaagtcgacttatttcagcacaggttccgcctcgagttatcacagtatg
gaagatgataatagcacagagattgatgcagaaaacatctgtaacaatcaagttatgtat
ggaccatcatctacacttccggcgctaacatcgcagttctcaaattgctggacaacgatt
caaggagaattcataatggtacatgcagcatatcaaacacatttgggacaggactatttt
tttgcgccacgtgctgcattagctgatggaattatttggcttttaatagctaaagccggt
atatcacgagccaatttagttcaatttttattaggtctgagtagtggaactcatgtgact
tgccctggcgttgatatgatacctgtgaaggcatttcgaatagaacctatggaaggaacg
agtggacatataaccgtagacggtgaggaagttgattacggaccgctgcaagccgagata
ttctcttccttagcatcggtgatgacaccctga

DBGET integrated database retrieval system