KEGG   Atta cephalotes (leaf cutting ant): 105627180Help
Entry
105627180         CDS       T04923                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
KEGG Orthology (KO) [BR:acep00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acep01009]
    105627180
Enzymes [BR:acep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     105627180
Protein phosphatases and associated proteins [BR:acep01009]
 HAD phosphatases
  Other HAD phosphatases
   105627180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 105627180
NCBI-ProteinID: XP_012063856
UniProt: A0A158P248
Position
Unknown
AA seq 231 aa AA seqDB search
MSIDTYNKVTHCIFDMDGLLLDTEHLYTKAFNRIANRYGKEFTWEHKAQTMGFKTKDIAD
YIIKTLELPLTKDEFKEEIVGLYQGLFPHTNPMPGVVRLLKHLKENNIPIALATSSDRKN
YELKTSRWHDLFEFFHHKVLGGSDPEVVHGKPEPDIFIIAAKRFPDNPNPLKCLVFEDAP
NGVKAALKAGMQVVMVPDPMLPKRYTTEATLVLDSLEKFEPEKFGLPPYKI
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgatacatacaacaaagtcacgcactgcattttcgatatggacggtttgttg
ctcgatacagaacatctgtacaccaaggccttcaatcgtatcgctaatcgttatggtaaa
gaattcacgtgggagcacaaggcgcaaacaatgggttttaagaccaaagacattgctgac
tacataattaagacattagaattaccgttaacaaaggatgaattcaaggaggagattgtt
ggactctatcagggattgtttccgcataccaatcccatgccaggcgtcgttaggttattg
aagcacctgaaagaaaataatattccgattgcgctagccacgagctcggaccgaaaaaac
tatgaattgaaaaccagtcgctggcacgatctcttcgaattctttcatcacaaagtactc
ggcggttcggatcctgaagtcgtgcacggaaaaccggaacctgacatatttatcatagct
gccaagcgtttccctgacaatccgaatcctttgaagtgtttggttttcgaagatgcgccg
aatggcgtgaaagcggcacttaaagccggaatgcaggttgttatggtgccggacccgatg
cttcccaaacgttatacgaccgaagcgactctagtcttagatagtctggagaagtttgaa
ccggaaaagtttggactacctccatataaaatataa

DBGET integrated database retrieval system