KEGG   Atta cephalotes (leaf cutting ant): 105627652Help
Entry
105627652         CDS       T04923                                 

Definition
(RefSeq) autophagy-related protein 16-1-like
  KO
K17890  autophagy-related protein 16-1
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep04136  Autophagy - other
acep04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:acep00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105627652
   04136 Autophagy - other
    105627652
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acep04131]
    105627652
   03029 Mitochondrial biogenesis [BR:acep03029]
    105627652
Membrane trafficking [BR:acep04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    105627652
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    105627652
Mitochondrial biogenesis [BR:acep03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    105627652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 Prefoldin_2 Cluap1 HbrB
Motif
Other DBs
NCBI-GeneID: 105627652
NCBI-ProteinID: XP_012064319
UniProt: A0A158P3G1
Position
Unknown
AA seq 313 aa AA seqDB search
MTSNEAAVSLGVAREDINWRKDLISQLRERNRSQTNCFADLISLHNRLFENANTLRNSNM
QLTIANETLRREAANGGIGMGGNPDLEARLLKQAEELAMLHKRKGEHTQQIVDLNNKLQE
MTKELHGKEISLAESSEANTNLRLEITKCLAREKDLEGINQMLKDEHQALQLAFASLEEK
LRKTQEENRQLIERLIKYKARDAEKMNEENDNFLSFTSPTTFLMHTLSKFGKRQAKMQKE
LEDAARDTRPVSPDRLSLKEVAGLPTAVPTKVSVTFSAHEGEVFAVKWSPTDRILATGGT
DRKVKLWSINKGK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaacgaagcagccgtgtcgctcggtgttgcccgggaagacatcaactggcgg
aaagatttgatttcgcaattacgcgagagaaacagatcgcaaaccaattgttttgcagat
ctcattagcctacacaatagattatttgaaaatgcaaatacattgcgaaattcaaatatg
caattgacaattgcaaatgagactcttcgtcgcgaagcagccaatggtggtattggcatg
ggtggaaatcccgatctcgaagctagactcttaaagcaagcggaagaattggcaatgctg
cataaaaggaaaggagaacatacgcaacaaatagtagatctcaataataaattgcaggaa
atgacaaaagaacttcatggaaaggaaattagtcttgcagaaagttcggaagctaatact
aacttacgtttagaaataactaaatgtcttgctagagagaaagatttagaaggcattaat
cagatgctcaaagatgaacaccaagccttgcaacttgcttttgcatctttagaagaaaag
cttagaaaaacacaggaagaaaatcgacagctgatcgagcgtttaataaaatataaagcc
agagatgcggaaaagatgaatgaagaaaatgataactttttaagttttacgagcccaaca
acctttttgatgcataccttatcaaaatttgggaagagacaagcaaagatgcaaaaggaa
ttggaagatgcagcccgagatacgcgacctgttagtccggatcgtttaagcttaaaagaa
gttgctggtcttccgacagcagtgccaacgaaagtatccgtaacgtttagtgcccatgag
ggggaagtattcgctgttaaatggtcgcctactgatagaatattggctactggaggtact
gacaggaaggtgaagctttggagcattaataaaggtaaataa

DBGET integrated database retrieval system