KEGG   Atta cephalotes (leaf cutting ant): 105627752Help
Entry
105627752         CDS       T04923                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00511  Other glycan degradation
acep00600  Sphingolipid metabolism
acep01100  Metabolic pathways
acep04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105627752
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    105627752
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105627752
Enzymes [BR:acep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     105627752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 105627752
NCBI-ProteinID: XP_012064422
UniProt: A0A158P3R4
Position
Unknown
AA seq 523 aa AA seqDB search
MKYAIILVLAVAATIESTNGCKIKRRSEFGDGSGDDGYYCVCDMTYCDEAPNVSKTTNYS
KYFLITSSKSGFLFHVSNGIYKKSKTIDTSAPLGKITINRKDVYQEIYGFGGAVTDSAAM
NIHNLTLEVSEQLLRSYFGPHGINYNFIRTPMGGCDFSMRPYTYAMVENDTSLHHFELQV
EDNLFKIPIIKRAQKIKKGKIKLLTAPWSASLWMKTKNSWTLDAKLRPEYRQLWADYFVK
FFEAYRHNGLEFWATTSQNEPENYKYIPVINNNTLINAMAWTAEEERDWIINNLAPTLKK
NNFGHIKIFIMDDTRLSMPDWPKIVFKDKRVKDIVSGTAVHFYFDHFISPSVLDEIKELF
PEHSILYTEGCAGVFEDQKVILGSWKRAELYAANIIENMSHWVSTWIDWNIALDTNGGPN
WIQNFVDSPIIVNSTANEFYKQPMFYAIGHFSKYVPPGSKRIGIKSKNIANMRKVAFSTS
DGGIVLVILNLNEEDKEILIQDPEKGTTKLKILAKSLNTMKYW
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgcaattatccttgttcttgctgttgcagcgacaattgagtcaacaaatggc
tgcaaaatcaaacgtcgatcagagtttggagacggaagcggagatgatggatattattgc
gtttgcgatatgacgtactgcgacgaagctccgaacgtgagcaagacaaccaattactct
aaatatttcctaataacatctagcaaaagtggttttctctttcacgtatcaaacggtata
tacaaaaagtctaaaacgattgacacatcagctccattgggaaagatcactataaatcga
aaagatgtataccaagaaatctatggatttggtggagctgtaactgattcagcggctatg
aacattcataacctaacgctcgaggtatccgagcagttgttgagaagctactttggtccg
catggtatcaattacaatttcattagaacgccaatgggtggctgtgatttctcaatgaga
ccttacacttacgcaatggtagaaaacgatacttcgcttcatcacttcgaattgcaagta
gaggataatcttttcaagataccgataataaaacgagctcaaaaaataaaaaaagggaaa
attaaattgttgactgcaccatggagcgccagtctttggatgaaaactaagaactcttgg
acgcttgatgctaaattacgtccagaatatcgacaactatgggcagattatttcgtaaaa
tttttcgaggcttatcgtcataatggtttagaattctgggctacaacgtctcagaatgag
ccagaaaattacaagtatattccggtaattaataataatacgcttatcaacgcaatggca
tggacagccgaggaagaacgtgactggattatcaataacttggcgccaaccttaaagaaa
aataatttcggacatatcaaaatcttcataatggatgataccagactatcgatgcctgat
tggccaaaaatagtatttaaagataaaagagtaaaagatattgtttctggaactgcggtc
catttttattttgatcattttatcagtccgagtgtcttggatgaaataaaagagctgttt
ccagaacactcaatattatacacggaaggttgcgctggagttttcgaagaccaaaaagtg
atactgggatcatggaaacgtgccgaattgtacgcagcgaatatcattgaaaacatgtcg
cattgggtgtccacttggatcgattggaacattgctttagatacgaatggtggacctaat
tggatccaaaattttgttgattctccaataatagtcaatagcactgccaacgaattctat
aagcaaccgatgttctatgcaattggacatttttcaaagtatgtcccacctggcagtaag
agaattggcataaaatcgaagaatatcgcgaatatgcgaaaggttgcattttccacgtct
gatggcggtatcgtattggtgatcttaaatctgaacgaagaggacaaagaaattttgatc
caggatccagagaaaggaacaacaaagctaaaaatccttgcaaaatccttaaataccatg
aaatattggtga

DBGET integrated database retrieval system