KEGG   Acetobacter sp. JWB: DS739_05980Help
Entry
DS739_05980       CDS       T05544                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
acet  Acetobacter sp. JWB
Pathway
acet00450  Selenocompound metabolism
acet00970  Aminoacyl-tRNA biosynthesis
acet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DS739_05980
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DS739_05980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acet01007]
    DS739_05980
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acet03016]
    DS739_05980
Enzymes [BR:acet01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DS739_05980
Amino acid related enzymes [BR:acet01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DS739_05980
Transfer RNA biogenesis [BR:acet03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DS739_05980
 Prokaryotic type
   Other AARSs
    DS739_05980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AXC26376
Position
1249369..1250907
Genome map
AA seq 512 aa AA seqDB search
MTRRFYVTTPIYYVNGAPHIGHAYTSIAADVMARFHRLAGDEVFFLTGTDEHGQKVEQAA
QANGIDAKSFADKVSADFRNMADAMNISYDDFIRTTEPRHITSTQALWKKVADNGAIYLG
AYEGWYALRDECFYGEDELVPGPDGKKVAPTGAPVEWVKEPSYFFKLSEYQDRLLELYEN
NPDFLGPHGARNEIVSFVKQGLRDLSISRTSFKWGIPVPGDDKHVMYVWFDALANYLSAL
GYPDTSAPRMAFWPANLHLVGKDIARFHAVYWPAFLMAAGIELPRKVFANGWWTIEGQKM
SKSLGNVVDPRDLVKEFGLDAVRFFLLREVPFGGDSDLSRKALIMRNNVELANDLGNLAQ
RTLSLVARNCGGVLPERRTLTEEDTHLLGQVMVLPDLLKSQIERCALTDALEDVWKVIRA
CNAYIDHQAPWALRKTDPERMKDVLRVLVDALRGIATMLQPFMPQSMERMLDQLSVTAEE
RSFAALETPLPGGRQLPAPQGIFPRYVEPEQA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcgtttctatgtaactacgcccatctattacgtgaacggagcgccccatatt
ggccacgcttacacgtctattgctgcggatgtgatggcccgctttcatcgtctggcaggg
gatgaggtcttctttctgacaggcacggatgagcacggccagaaggtagagcaggctgca
caggccaatggcatagatgccaaaagctttgcggataaggtttcggccgatttccgcaat
atggccgatgccatgaacatctcgtatgatgatttcatccgcacgacagagccgcgccat
attaccagcacgcaggcattgtggaaaaaagtggcggataacggggccatttatctgggc
gcgtatgagggctggtatgctctgcgtgatgaatgcttctatggtgaagatgaactggtg
cccggcccggatggcaaaaaagttgctccaacaggcgcaccggtagaatgggtgaaggaa
ccctcttacttcttcaagctgtctgaatatcaggatcggctgctggagctgtatgaaaat
aatccggattttctgggccctcatggtgcgcggaatgagattgtaagctttgttaagcag
ggcctgcgcgatctttccatcagccgtaccagttttaagtggggcattcctgttccgggt
gatgataagcacgttatgtatgtgtggtttgatgcactcgccaattacctgagcgctctg
ggctatccggatacctctgccccgcgcatggcgttctggcctgccaacctgcatctggtt
ggcaaggatattgcacgcttccatgccgtttactggcctgccttccttatggctgctggt
attgagctgccacgcaaggtgtttgccaacggctggtggaccattgaaggccagaagatg
agcaaatctctaggcaatgtggtggacccgcgtgatctggttaaagaattcgggctagat
gctgtgcgcttcttcctgctgcgcgaagtgccttttggcggggatagtgatctttctcgc
aaggcgctgattatgcgcaataatgtggaattggcgaatgatctgggcaatctggcccag
cgtacgctttctcttgtagcgcgtaactgcggtggtgttctgccagaacgtcgtacgcta
acggaagaagatacccatctgctagggcaggtgatggtgctgcccgatctgctgaaatct
cagatcgagcggtgtgcacttacagatgcgctggaagatgtgtggaaggtgatccgcgct
tgcaacgcgtatattgaccatcaggccccgtgggcgttgcgcaagacagacccagaacgc
atgaaggacgtgttgcgtgtgttggtagatgccctgcgcggtattgccaccatgctccag
ccgtttatgccgcagagcatggaacgcatgttggaccagctttctgttacggcagaagaa
cgcagctttgccgcgctggaaacaccattgcccggtgggcgtcagcttccggcaccacag
ggcattttcccccgttacgttgagccagaacaggcataa

DBGET integrated database retrieval system