KEGG   Acetobacter sp. JWB: DS739_06415Help
Entry
DS739_06415       CDS       T05544                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
acet  Acetobacter sp. JWB
Pathway
acet00770  Pantothenate and CoA biosynthesis
acet01100  Metabolic pathways
Module
acet_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:acet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DS739_06415 (coaBC)
Enzymes [BR:acet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     DS739_06415 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     DS739_06415 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: AXC26460
Position
1335662..1336891
Genome map
AA seq 409 aa AA seqDB search
MDVALPSRSVLLIVGGSIAAFKAPELIRLLKGAGMQVRCVLTEGGSQFVTPLTLQALSEQ
PVYADLFSLTAEQEMGHIALSRWADLVLVCPASANLLARMAGGLADDLASTLLLATDAPV
MAVPAMNVRMWEHAATQHNVATLQQRGVHVVPPAIGPMACGEFGAGRMPEPADILDAVQA
FFRQRQQQNGPLAGKSVLVTAGPTQEPLDPVRYLANRSSGKQGYAIAAALADLGASVTLV
SGPTMLRAPAGVTFVPCETACQMLECVKAAAPFDAAVCTAAVADWRPEVQAGQKIKKTSR
DDVPAPIRLVSNPDILAEISAPGPQRPMLVVGFAAETEKVEEHATAKRQRKGCDWIVAND
VSAGTGIMGGDRNQVVLITAEGSERWPHMPKEEVAQRLASRMADWFTES
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggctttgccttcccgttccgttttgcttattgtgggcggcagtattgccgcc
ttcaaggcgccggagttgatacgtctgcttaaaggcgctggcatgcaggtgcgctgcgtg
cttacggaaggcggaagccagtttgtaacgccccttaccctgcaagcgttaagtgagcag
ccggtttatgcagacctgttctcgttaacggctgagcaggaaatggggcatattgcgctt
tcccgctgggcagatttggttcttgtttgccctgcatctgccaatttactggcacgcatg
gccggtggtctggcggatgatctggccagcacgcttttattggcgacagatgcacctgta
atggccgttcccgctatgaatgtgagaatgtgggagcacgctgctacgcagcataacgtg
gccacgttacagcagcgcggcgtacatgttgtgccgccagctattggccccatggcctgc
ggtgaatttggcgcaggccggatgccggaacccgccgatattttggatgccgtgcaagca
tttttccgccagcggcaacagcagaatggccctttggcgggtaagtctgttttggtaaca
gcgggccctacgcaagaaccgctggatcctgtaaggtatctggctaaccgatcttccggc
aaacagggctatgccattgctgcggcgttggcggatcttggagcttccgtgacattggta
agtggcccaaccatgttgcgtgcgcctgctggtgttacgtttgttccgtgcgaaacagct
tgccaaatgctggaatgcgttaaggcagcagctccgtttgatgcggctgtctgcaccgcg
gcggtggcagattggcggcctgaggtgcaagcggggcaaaaaattaaaaaaaccagccga
gatgatgtgcccgctcctattcggctggtgtctaacccagatattctggccgaaatttcc
gcccccggcccacagcgcccgatgcttgttgtggggtttgccgcagaaaccgaaaaggtg
gaggagcacgcaaccgccaagcgccaacgcaaaggatgtgactggattgttgcaaacgat
gtaagtgctggcacaggcattatggggggtgatagaaatcaggttgttctgataaccgcc
gaaggcagtgagcgctggccacatatgccaaaagaagaagttgcacaaaggcttgcttct
cgcatggcagattggtttacagaatcctga

DBGET integrated database retrieval system