KEGG   Acetobacter sp. JWB: DS739_06585Help
Entry
DS739_06585       CDS       T05544                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
acet  Acetobacter sp. JWB
Pathway
acet00010  Glycolysis / Gluconeogenesis
acet00071  Fatty acid degradation
acet00350  Tyrosine metabolism
acet00625  Chloroalkane and chloroalkene degradation
acet00626  Naphthalene degradation
acet00680  Methane metabolism
acet01100  Metabolic pathways
acet01110  Biosynthesis of secondary metabolites
acet01120  Microbial metabolism in diverse environments
acet01130  Biosynthesis of antibiotics
acet01200  Carbon metabolism
acet01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DS739_06585
  09102 Energy metabolism
   00680 Methane metabolism
    DS739_06585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DS739_06585
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DS739_06585
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DS739_06585
   00626 Naphthalene degradation
    DS739_06585
Enzymes [BR:acet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DS739_06585
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     DS739_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 MinC_C Met_10 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AXC26489
Position
complement(1371838..1372953)
Genome map
AA seq 371 aa AA seqDB search
MKSRAAVAFKPGQPLEIVEIDVAPPQAGEVLVKILNTGVCHTDAFTLSGQDPEGLFPVVL
GHEGAGIVMEVGEGVTSVKPGDHVIPLYTAECGKCEFCTSGKTNLCIAVRATQGKGVMPD
GTSRFSYKGQPLYHYMGCSTFSEYTVVAEVSLAKINPESNPEQVCLLGCGVTTGIGAVHN
TAKVQEGDSVAVFGLGGIGLAVIQGARQAKAGRIFAIDTNPDKFELAKAFGATDFINPKD
YEAPIQQVIIEMTGWGVDHSFECIGNVEIMRAALECAHRGWGQSVVIGVAGAGKEISTRP
FQLVTGRTWKGTAFGGVKGRTQLPGMVEDAMAGKIDLAPFVTHTMPLEDINTAFDLMHEG
KSIRSVIHYTP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgcgccgcagttgcattcaaaccgggccagcctctggaaattgttgaaatt
gatgtagcccccccacaggccggggaagttctggttaaaatcctaaacactggcgtttgc
cacacagatgccttcactctttcggggcaggacccggaaggcctctttcccgttgtgctg
gggcatgagggcgcaggtattgtgatggaagttggcgaaggcgttaccagtgttaagccc
ggagatcacgttattccgctatatacggcagaatgcggtaagtgtgagttctgcacttct
ggcaaaaccaacttgtgtattgcagtgcgtgccacgcagggtaaaggtgtgatgccggat
ggcaccagccgtttttcctacaaaggtcagccactttaccactacatggggtgttccacc
tttagtgaatacacggtggtagccgaagtttccttggctaaaatcaacccagaatctaac
cccgaacaggtttgcctactaggctgtggcgttaccacaggcattggggccgtacacaac
acggccaaagtgcaagaaggggattctgtagctgtttttggcttgggcggtatcgggcta
gccgttattcagggtgcgcgccaagccaaggccggacgaatttttgctattgatactaac
ccggacaagtttgaactggccaaggcttttggagctacggatttcatcaatcccaaggat
tatgaagcccccattcagcaggttattattgaaatgacaggttggggcgtggaccacagc
tttgaatgtatcggcaatgttgaaattatgcgcgcggccttggaatgtgcacaccgcggc
tggggccaatctgtagttattggcgtagccggtgccggaaaggaaatttccacccgtccg
ttccagttggtaacgggccgtacatggaaaggcacggcatttggtggcgttaaaggccgt
acacagctccccggcatggtggaagatgccatggcaggcaaaattgatctggccccattt
gtaacccacaccatgccactggaagatatcaacacagcgtttgacctgatgcacgagggc
aaatccattcggagtgtaattcactacaccccgtaa

DBGET integrated database retrieval system