KEGG   Acetobacter sp. JWB: DS739_12345Help
Entry
DS739_12345       CDS       T05544                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
acet  Acetobacter sp. JWB
Pathway
acet00970  Aminoacyl-tRNA biosynthesis
acet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acet00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DS739_12345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acet03029]
    DS739_12345
Enzymes [BR:acet01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DS739_12345
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DS739_12345
Mitochondrial biogenesis [BR:acet03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DS739_12345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXC27453
Position
2611381..2612868
Genome map
AA seq 495 aa AA seqDB search
MLTGLTLTQAREGLAARKFSARELAKAQLDAIARLNPVLNAYITVLPEETVLAAADAADA
RYAAGTAGLMDGLPIGVKDLFCTKGVRTTAASKMLENFVPPYESTVTANLLKAGAVFLGK
TNLDEFAMGSANITSAFGPVASPWKRKDDPSAILVPGGSSGGSSAAVAAGLGLAATGTDT
GGSIRQPAAYCGIVGLKPTYGRCSRWGTIAFASSLDQAGPMTRSVADAGLMLEAMAGFDE
KDSTCSNRPVPAFSKAVGKSVKGLRVGIPTEYRSPNLPAEVVAMWEKGIAWLKEAGCEIV
DVSLPHTKYGLTTYYIIAPAECSSNLARYDGIRFGIRKDAPTLDGVYEATRAAGFGAEVR
SRILMGTYVLSAGYYDAYYLKAQKVRTLIKRDFEQAFENVDVLLTPTAPSAAFAQGENMD
DPVQMYLNDIFTVPASMAGVPALSVPVGLNGNGLPLGLQVIGKHFDEETVLSIGGALEAA
AGFTHLPSVHAGAGA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccggactgacgctcacccaagcgcgtgaagggcttgccgcccgcaaattttct
gcacgggagctggccaaagcccaactagacgccattgcccgcctcaacccggtgctcaac
gcctatattaccgtgctgcctgaagaaaccgtattggctgcggcagatgcggcagatgcc
cgctatgccgcaggcactgccgggcttatggatggcctgcccattggtgtaaaagatctg
ttctgcaccaaaggtgtgcgcaccacggctgccagcaaaatgctggaaaactttgtgccg
ccttatgaaagcacagttacggccaacctactaaaagctggcgcggtctttctcggcaaa
accaatcttgatgaatttgccatggggtctgccaacatcacctcggctttcgggccagtg
gcaagcccgtggaagcgcaaggatgatccctccgctatacttgtaccgggcggctcttcc
ggtgggtcttctgctgctgttgctgctgggctgggccttgctgctacaggcacggataca
ggtggctccatccgtcagcctgctgcttattgtggtattgtggggcttaaaccgacctat
ggccgttgcagccgctggggcaccattgcctttgcaagctcgcttgatcaggctggccct
atgacacgcagcgtggcagatgccgggctgatgctggaagccatggctggctttgatgaa
aaagacagcacctgctccaaccgccctgttcccgcgtttagcaaagctgttggcaaaagc
gtaaaaggcctgcgcgtgggtattcccacagaatatcgttctcccaacctgcctgcagaa
gttgtggccatgtgggaaaagggcattgcgtggttgaaagaagcaggctgcgagattgtg
gacgtttctcttccgcacaccaaatacggcctgactacatattacattattgccccggct
gaatgttcctccaacttggcgcgttatgatggcatccgctttggcattcgtaaggatgcc
cccacactggatggtgtatatgaggccacacgcgccgcagggtttggggcagaagtgcgc
agccgtatcctgatgggcacctatgtgctttctgctggctattacgatgcctactatctg
aaagcccagaaagtgcgcacccttatcaagcgcgattttgaacaggcgtttgaaaacgta
gatgtgctgcttacccctaccgcgccatccgctgcctttgcgcagggtgaaaacatggat
gacccggtgcagatgtatctgaacgacatctttaccgtacccgccagcatggccggtgtg
cctgccctttctgttccggtggggcttaatggcaatggtctgccgctagggttacaggtg
attggtaaacattttgatgaagaaaccgtgctgtctattggcggcgcgttagaagcggcg
gcgggctttacgcaccttccgtccgtacatgcgggagcaggcgcatga

DBGET integrated database retrieval system