KEGG   Acetobacter sp. JWB: DS739_12350Help
Entry
DS739_12350       CDS       T05544                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
acet  Acetobacter sp. JWB
Pathway
acet00970  Aminoacyl-tRNA biosynthesis
acet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acet00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DS739_12350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:acet03029]
    DS739_12350
Enzymes [BR:acet01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DS739_12350
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DS739_12350
Mitochondrial biogenesis [BR:acet03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DS739_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AXC27454
Position
2612865..2614319
Genome map
AA seq 484 aa AA seqDB search
MSYVIEGKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVSLVDAAFPGMLPVI
NKECVAQAIRTGLGLNAQINLFSRFDRKNYFYADLPQGYQISQFEHPIIGTGSIEIELQS
GETRQIGITRLHLEQDAGKLLHDQDPSKSFVDLNRAGVALMEIVSEPDICEPEEAGAYLR
KLRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRFVMQAIEVEAT
RQIEIWENGGEVDQETRLFDPGRGETRTMRSKEDAHDYRYFPDPDLLPLVVEQAWVDDLK
SKLPELPDAKRARFQKDYGIPSYDAGVLVAEQAVADFYETVAKGRDGKLAASWVIGDLFA
ALNRTSNTIETSPVSAASLGKMLDLIADGTINGKIAKEVFEDMVETGDSPDAIVERKGLR
QVTDTGVIDSAIAAILEKHADKVAEYRGGKDKLFGFFVGQVMKETKGKANPALVNSALKA
QLDG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgtaattgaaggtaaaaccggcccgtgggaaattgtggtcgggctggaagtg
cacgcacaggttatcagccagtccaagctgttttctggtgcttctacaaaatttggggga
gacccgaacactcaggttagcctggttgacgcagcctttcccggcatgttgcctgttatc
aacaaggaatgcgtggcgcaggccatccgcaccgggttggggctgaatgcccagatcaac
ctgttcagccggttcgaccgtaaaaactacttttacgccgacctgccacagggttaccag
atcagccagttcgagcacccgattattggcacgggttctatcgaaattgaacttcagagc
ggtgaaacacgccagattggcattacccgcctgcatctggaacaagacgctggcaagctg
ctgcatgatcaggacccctcaaaatcctttgtggatctgaaccgtgcaggcgtagccctg
atggaaattgtgagcgaacccgatatttgcgaaccagaagaggccggggcttacctgcgt
aagctacgccagattctacgctatctgggcacgtgtgatggcaacatggaagaaggctcc
atgcgtgcagacgtaaacgtttccgtgcgcaaagcgggcgagcctttccgcactcgctgc
gagatcaaaaacgtcaactccatccgctttgtcatgcaggccattgaggtggaagccacc
cgccagattgaaatctgggaaaacggcggagaagttgatcaggaaacacgcctgtttgat
ccgggccggggtgaaacccgcaccatgcgctccaaggaagatgcgcatgattaccgctac
ttcccagatcctgacctgctgccattggtagtggaacaggcgtgggtggatgatctgaaa
tctaagctgccggaactgccagacgcaaagcgtgcccgcttccagaaagactacggcatt
ccgtcttacgatgctggcgtgctggttgcagaacaggccgtagctgatttttacgaaacc
gtggccaaagggcgcgatggcaagctggcggcaagttgggtgattggtgatctgtttgcg
gctcttaaccgcaccagcaacaccattgaaaccagccctgttagcgcagcttccttgggc
aaaatgcttgatctgattgcggatggcaccattaacggtaagattgccaaggaagtgttt
gaagacatggtggaaacgggtgatagcccggatgccattgtggaacgcaaaggcctgcgg
caggtgaccgacacaggagttattgattccgccattgctgccattttggaaaagcatgca
gataaggtggctgaataccgtggcggcaaagacaagctgtttggattctttgtggggcag
gtcatgaaggaaaccaaaggtaaggcgaaccctgccttggtcaattcggccttaaaagcc
cagttagacggctaa

DBGET integrated database retrieval system