KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0039Help
Entry
AciM339_0039      CDS       T02396                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
acf  Aciduliprofundum sp. MAR08-339
Brite
KEGG Orthology (KO) [BR:acf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AciM339_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGB03941
UniProt: L0HJG8
Position
complement(40699..41628)
Genome map
AA seq 309 aa AA seqDB search
MLELAYIFLAAVVSFVIAANNSAGSVGTLYGSRITSYYRAAFMAGFFVMLGTFLEGWKMS
GAIEGGLISYPLGLEMSLLVLLSVILLMLLFTILAVPMSASQLMVGSIIGVAFAFGWSIN
GGFTAFIVVSWILNFAISLFLSLSIYVLTSRLTKHFNVFALSRFYTVSLLISSAFMAYTL
GANTIGLIASLNLSWYSIIVTGVAALVGTVVLGKRTVVTVGSRITNMDPPRAFAAQIAGA
IVVEAFTQIHLPVSITQAIIGGVIGTGMVKGYRELNKKTVKNLFLSWSIAPIVGFALTYF
IVMVLSWHI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacttgcctatatttttttggccgcagtcgtaagtttcgtgatagccgcaaac
aactcggccgggagtgttggaacgctctacggctctaggattacctcgtattatagagcc
gcatttatggccggattttttgttatgctcggtacatttcttgagggctggaaaatgtct
ggggccattgagggggggctcatctcttatccactgggtcttgaaatgtctctgctggtt
ttgctctctgttatcctgctcatgcttctctttacgatccttgcagttcccatgtccgcg
tcccagctgatggtcggttcaataataggtgttgccttcgcttttgggtggagcataaat
ggtggatttacggcattcatcgttgtttcttggattttgaatttcgccatatcccttttc
ctgtctctctcaatatacgttcttacgtctaggctcacaaaacatttcaacgtttttgcc
ttgagccgtttttacacagtttcactgctgataagcagcgcctttatggcctataccctt
ggggcaaacaccatagggctgatagcatccttgaatctttcctggtattctattatcgtg
acaggtgttgccgctctggttggcacggtggttttggggaagagaacggtagtcaccgtt
ggaagcaggataaccaatatggatcctccaagggcctttgctgcccagatagctggagcc
attgttgttgaggcatttacccagattcatcttcctgtgtccataacccaggccataata
gggggtgttataggaaccgggatggtgaagggatatcgggaattgaataagaaaactgtg
aaaaatctgtttttatcatggtccattgcgccgatagttggttttgcccttacctacttc
atagttatggtgttatcttggcacatatga

DBGET integrated database retrieval system