KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1144Help
Entry
AciM339_1144      CDS       T02396                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
acf00020  Citrate cycle (TCA cycle)
acf00640  Propanoate metabolism
acf00660  C5-Branched dibasic acid metabolism
acf00720  Carbon fixation pathways in prokaryotes
acf01100  Metabolic pathways
acf01110  Biosynthesis of secondary metabolites
acf01120  Microbial metabolism in diverse environments
acf01130  Biosynthesis of antibiotics
acf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciM339_1144
   00640 Propanoate metabolism
    AciM339_1144
   00660 C5-Branched dibasic acid metabolism
    AciM339_1144
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AciM339_1144
Enzymes [BR:acf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AciM339_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA GARS_A ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AGB05009
UniProt: L0HPJ2
Position
1028290..1029396
Genome map
AA seq 368 aa AA seqDB search
MNLYEYQGKALFRKFGVPTPEGYVVFKPEEIGEVNRDVVIKAQVLTGGRGKSGGVKFAST
ADEARKLAEEILSMEIKGHKVHAVLVEEKLKIEKEYYLSILIDRSTRSPLIMASPEGGVE
IESVPDEKIYKYRVNPEIGVQPFVGRILSKKMGFTGDMAKQFTAILMNLYKLFREYDAEL
VEINPLVLSVGKLIAADSKVVIDSDSLYRHKDLEENAEEKTPLELEANRAGYAFVELDGN
IGVIANGAGLTMATLDTLLLYGLKPRNFLDLGGTDSVDITKNAFTYVLKANPEAILVNIF
GGVTKCDTVAQGIIAAKEEFKIDMPIVVRLSGVHEEEGRKMLADAGIHAFADMRHAIEKL
KKVMEGSE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtacgagtatcaaggaaaggcgctgtttaggaaattcggagtgcccactccc
gagggctatgtggtattcaagcccgaggagataggggaagtgaacagggacgtggtcata
aaagctcaggtcctcacgggtggccgtggcaagagtggaggagtgaaatttgcctccacc
gcggatgaggcgagaaaacttgccgaggaaattctttctatggagatcaaggggcacaaa
gtgcatgcggtgcttgtggaagaaaaactcaaaattgaaaaggagtactacctgagcata
ctcattgacaggagcaccagatctccgctcataatggcttctcctgagggcggggtggaa
atagagagcgtgcccgatgagaagatttacaagtacagagtgaatcctgagattggggtg
cagccattcgtaggaaggattctctccaagaagatgggtttcacaggcgatatggcaaag
cagtttacggccatactcatgaacctctataaattattcagagagtatgatgctgaactt
gtggaaataaatccccttgtgctgagtgtgggtaagcttatagcggccgattccaaggta
gtaattgattctgactcgctctatcgccataaagacctggaggagaatgccgaggagaaa
actcctctggaactcgaggcaaatcgcgctggatacgccttcgttgaactggatggaaat
attggagtgatagcgaatggagcaggactaaccatggccactcttgatacactgcttctc
tacgggctcaagcccaggaacttccttgatctgggcggaactgatagtgtggatattacc
aagaatgcatttacctacgtgctaaaagccaatccagaggccattctggtgaatatattt
ggaggtgtgacaaaatgcgatactgtggcgcaggggataatagcggcaaaggaggaattc
aaaatagatatgcccattgttgtgcgccttagcggtgtgcatgaggaagagggaagaaag
atgctggctgatgcgggcattcacgcatttgctgatatgaggcatgcgattgaaaagctc
aagaaggttatggagggatcagaatga

DBGET integrated database retrieval system