KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1336Help
Entry
AciM339_1336      CDS       T02396                                 

Definition
(GenBank) pyruvate/oxaloacetate carboxyltransferase
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
acf00020  Citrate cycle (TCA cycle)
acf00620  Pyruvate metabolism
acf00720  Carbon fixation pathways in prokaryotes
acf01100  Metabolic pathways
acf01120  Microbial metabolism in diverse environments
acf01200  Carbon metabolism
acf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciM339_1336
   00620 Pyruvate metabolism
    AciM339_1336
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AciM339_1336
Enzymes [BR:acf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AciM339_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Spc42p TGT
Motif
Other DBs
NCBI-ProteinID: AGB05198
UniProt: L0HPD5
Position
complement(1198956..1200383)
Genome map
AA seq 475 aa AA seqDB search
MVKITDTTLRDGHQSLFATRMRTEDMVPIAEAMDEMGFFSLEVWGGATFDSAMRFLNENP
WDRPKILKKYIKNTPLQMLLRGQNLVGYRHYPDDIVEKFVFKAHKAGIDIFRIFDALNDI
RNMETAIRAVKRAGAHAQGSVVYTISPIHTLESYVDMAKKLEELGVDSICIKDMAGLMSP
TVAYKLVKMLKREISVPIDLHTHSTAGWAPVTYMKAVEAGVDVIDTAMSPFGFGTAQPAT
ESMVAALQGTEYDTGMDLKKLEKIAEYFRGVEKKLRKYTRMEMRMADTRVLIYQVPGGML
SNLYNQLREMKAEDKIEEVLAEVPRVRAEVGYPPLVTPLSQIVGTQAVMNVISGERWKMV
TKEMRNYIKGLYGKPPGEISADIKKKVLGDEKPITTRPADLLEPEFEKLKKEIGDLADNE
EDVLSYALFPDVARKFLMRRKGLLNEPIEPPRDGRKYKIWVNGEEYLVNVEELIE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagataacagataccacgcttcgcgacgggcatcagagcctttttgccacgagg
atgcgcacggaggatatggtgcccattgcagaggccatggacgagatgggttttttctcc
ctcgaagtctggggaggtgcaacatttgactccgctatgcgcttcctcaacgagaaccca
tgggacaggccaaaaattctgaaaaaatacattaaaaatactccattgcagatgctccta
agaggtcagaatcttgttggctataggcactatccggatgacatcgtggaaaaattcgtt
ttcaaggcccacaaggctggaattgatatatttcgcatattcgatgccctcaatgatata
aggaatatggagactgccataagagccgttaaaagagcgggtgcccacgcgcagggctcg
gtggtctacacgataagtcccatacatacccttgaaagttatgtggatatggcaaagaaa
ctggaggagctgggcgtggattccatatgcataaaggacatggccggactcatgagtcca
accgtggcctacaaactggtaaagatgctcaagagggagataagcgtgcccatagatttg
cacacccacagcactgccggttgggctcccgtaacttatatgaaggctgttgaagctgga
gtggatgtgattgatacagccatgtccccattcggcttcggcacggctcagcccgccaca
gagagcatggtggccgctctccagggcacagaatacgatacaggtatggatctgaaaaaa
ctggagaagatagcagaatatttcagaggcgtggagaaaaaattgaggaagtacacaagg
atggagatgagaatggccgacacaagggtacttatttaccaagttccaggcggaatgctc
tcgaatctctacaaccaactgagggagatgaaggccgaggataagattgaagaggttctt
gcagaagtcccaagggttcgtgctgaggtcggctatcccccacttgttacacccttgagt
cagattgtaggtacacaggccgttatgaacgtcatatctggagagaggtggaagatggtc
accaaggagatgaggaactacataaagggcctatatggcaagccaccgggagagatcagt
gcagatataaagaaaaaggttctcggagatgagaagcccataaccaccaggccagccgat
ctcctggagcccgaatttgaaaagcttaagaaagagattggagaccttgcagataacgag
gaggatgtgctctcctacgccctcttcccagatgttgcaaggaagttcctgatgcgaaga
aagggattgttgaatgagcccattgagccgcccagggatggaaggaagtacaagatctgg
gtaaatggagaggaatatcttgtgaatgtggaggaactgatagaatga

DBGET integrated database retrieval system