KEGG   Aerococcus christensenii: AWM71_00185Help
Entry
AWM71_00185       CDS       T04262                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acg  Aerococcus christensenii
Pathway
acg00071  Fatty acid degradation
acg00072  Synthesis and degradation of ketone bodies
acg00280  Valine, leucine and isoleucine degradation
acg00362  Benzoate degradation
acg00380  Tryptophan metabolism
acg00620  Pyruvate metabolism
acg00630  Glyoxylate and dicarboxylate metabolism
acg00640  Propanoate metabolism
acg00650  Butanoate metabolism
acg00900  Terpenoid backbone biosynthesis
acg01100  Metabolic pathways
acg01110  Biosynthesis of secondary metabolites
acg01120  Microbial metabolism in diverse environments
acg01130  Biosynthesis of antibiotics
acg01200  Carbon metabolism
acg01212  Fatty acid metabolism
acg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWM71_00185
   00630 Glyoxylate and dicarboxylate metabolism
    AWM71_00185
   00640 Propanoate metabolism
    AWM71_00185
   00650 Butanoate metabolism
    AWM71_00185
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AWM71_00185
   00072 Synthesis and degradation of ketone bodies
    AWM71_00185
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWM71_00185
   00310 Lysine degradation
    AWM71_00185
   00380 Tryptophan metabolism
    AWM71_00185
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWM71_00185
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWM71_00185
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AWM71_00185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acg04147]
    AWM71_00185
Enzymes [BR:acg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWM71_00185
Exosome [BR:acg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWM71_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMB91866
UniProt: A0A109RC50
Position
complement(51295..52542)
Genome map
AA seq 415 aa AA seqDB search
MLKQREEEIVIIGAARTPIGAYLGDLKTVPVERLGEISLQGAIERSGVSKDEIEEVIVGN
VIGSQTSNNLGRIIGLNVGLPVTSTGMTVNRICGSGMQSAVSACFSLLFSDKKVVAAGGV
ESLSRAPYYLPESVRYEGFRMGDQSLIDSQLAGLASASGRDLDIPHMGNTAENVARRYGI
TRQRADLFALHSQRKAAQAMSSGRLAEEIVPVEVTGKKGKVTIVDTDGHPRPDTTLEALS
RLKSAFEENGIVTAGNASGMNDGACFELFTTVSYAKEKSYPLMARVVDFEITGCDPAYMG
LGPVFAIRRLLERQQMTLENDIDILEINEAFASQTIGCLIELGIEEEGDYYKKHFNPNGG
AIALGHPLGMSGARLITSLVYEFKNHPEKRFGLASACIGGGQGIAILLENGSFLQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacagcgagaagaagaaattgttattattggagcagctaggactccaataggt
gcttatttaggcgatttgaagacggtccctgttgagcgattgggggagatcagtctccaa
ggcgccattgaacgatccggggtttcaaaggacgaaatagaggaagttattgttggtaat
gtgataggatcccaaactagcaataacttagggcgaattatcggccttaatgttgggcta
ccggtgacttcaacagggatgacagtgaatcgcatctgtggatctggcatgcaatcggca
gtttctgcttgtttttcattgcttttctcagataaaaaggttgttgctgcgggaggcgtt
gaatctttatcgcgggcgccttattatttgcctgaaagtgtgcgatatgaaggctttaga
atgggagaccagtctctcattgattctcaattagcagggcttgcttcagcgtcagggaga
gacttggatatcccacatatggggaatactgctgagaatgtagcgcgtcgctatggaatt
acaaggcaaagagcggatctttttgcccttcattctcaacgcaaagctgcccaagctatg
agtagtggacggttggctgaggaaattgtaccggttgaagtgactgggaaaaagggaaag
gttacaatagttgataccgatggccatccacgaccagatacgactttagaggctctctct
cggctaaagtctgcctttgaagaaaatggaattgtcactgcaggcaatgcttccggaatg
aatgatggggcttgttttgaattgtttacaacagtttcttatgctaaggaaaaaagttat
cctctcatggctcgggtggtggattttgaaattacagggtgtgatccggcttatatggga
ttaggacctgtttttgccattcgccgtttattggaaagacagcagatgactttggaaaat
gatattgatatccttgaaattaatgaggcatttgcttcccaaacgattggctgcttgatt
gaattaggaattgaagaagaaggagactattataaaaaacactttaatccaaatggagga
gcgattgctttaggacatcctttgggcatgtcgggagcgcgtttgatcacgagcttggtc
tatgaatttaaaaatcatccagagaaacggtttggattagcttctgcttgtattggaggc
ggacaaggcattgccatcttgcttgaaaacgggtcttttctccaataa

DBGET integrated database retrieval system