KEGG   Aerococcus christensenii: AWM71_05625Help
Entry
AWM71_05625       CDS       T04262                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
acg  Aerococcus christensenii
Pathway
acg00270  Cysteine and methionine metabolism
acg00920  Sulfur metabolism
acg01100  Metabolic pathways
acg01110  Biosynthesis of secondary metabolites
acg01130  Biosynthesis of antibiotics
acg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AWM71_05625
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AWM71_05625
Enzymes [BR:acg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AWM71_05625
    2.3.1.46  homoserine O-succinyltransferase
     AWM71_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AMB92789
Position
1184339..1185259
Genome map
AA seq 306 aa AA seqDB search
MPIKVKKNLPALKKLAGENIFVMDERRAKMQDFRSLEILIVNLMPTKEATEEQLLRLLSN
SPLQVNVTFLHMSSYNAKHTSSDHLEEFYRTFQDVSEKFFDGMIITGAPVEQRPFETVDY
WPELVAIMEWSEDHVFSTLHICWGAQAAMYYHFGLDKVDLPQKLFGVYRQHINKPEVSLM
RGLDDVFYIPHSRYTEIPRAAIEATKDLEVLISSEETGVSVAHTKDQRFVFVFGHVEYDA
DTLAKEYERDVKEGLHPQVPVNYYPKDDPRQKPLLRWRSTSNMLFTNWLNYYVYQETPFV
IEQISH
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaaagtcaagaaaaatttacccgccttaaagaaattagcgggagagaatatt
tttgtaatggatgaacgccgggcgaagatgcaagactttcgttccttggagattttaatt
gtcaaccttatgccaaccaaggaagcaacagaagaacagctattacgtttactcagtaat
tctccccttcaagtcaatgtgaccttcttgcatatgtcttcctataacgccaagcatacc
tcctcggaccacctcgaagagttctatcgaacctttcaagatgtgagtgagaagttcttc
gatggcatgattatcacaggcgctccagtagaacagcgcccctttgaaacggtggactac
tggccagaattagtagctattatggaatggagcgaagatcatgtcttctccactcttcat
atttgctggggagctcaagcagcgatgtattatcattttggcttggataaggtggacctc
cctcagaaactctttggagtctaccgccaacacattaataaaccggaagttagcctgatg
agaggtttagatgacgtcttctatattccccactcccgctatacagagatccctcgtgca
gccattgaagcgacgaaagacttagaagtcttgatttcttctgaagaaacaggggtcagt
gtggcccataccaaagaccaacgttttgttttcgtctttggacatgtggagtatgatgct
gacactctcgccaaagaatatgagcgggatgtgaaagagggccttcatccacaggttcca
gtaaattattacccgaaagatgatccccgccagaagcctcttcttcgctggcggtccact
tccaatatgctcttcaccaactggttgaactactacgtctatcaagaaacaccatttgtc
attgaacagatcagtcattag

DBGET integrated database retrieval system