KEGG   Pseudarthrobacter chlorophenolicus: Achl_0631Help
Entry
Achl_0631         CDS       T00834                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00071  Fatty acid degradation
ach00280  Valine, leucine and isoleucine degradation
ach00281  Geraniol degradation
ach00310  Lysine degradation
ach00360  Phenylalanine metabolism
ach00362  Benzoate degradation
ach00380  Tryptophan metabolism
ach00410  beta-Alanine metabolism
ach00627  Aminobenzoate degradation
ach00640  Propanoate metabolism
ach00650  Butanoate metabolism
ach00903  Limonene and pinene degradation
ach00930  Caprolactam degradation
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Achl_0631
   00650 Butanoate metabolism
    Achl_0631
  Lipid metabolism
   00071 Fatty acid degradation
    Achl_0631
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Achl_0631
   00310 Lysine degradation
    Achl_0631
   00360 Phenylalanine metabolism
    Achl_0631
   00380 Tryptophan metabolism
    Achl_0631
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Achl_0631
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Achl_0631
   00281 Geraniol degradation
    Achl_0631
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Achl_0631
   00627 Aminobenzoate degradation
    Achl_0631
   00930 Caprolactam degradation
    Achl_0631
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Achl_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Fucose_iso_N2
Motif
Other DBs
NCBI-ProteinID: ACL38629
UniProt: B8HBE4
Position
677920..678999
Genome map
AA seq 359 aa AA seqDB search
MTETAATPEAEVLFTRRGRLAVATLNRPKAVNALTAGMVDALLRQLTEWAEDGSVGTVLV
QGAGGRGLCAGGDIVAIYRDILRGGDDTADFWQAEYRLNYLISRYPKPYVALMDGLVLGG
GVGISAHGSVRVVTERTRTGMPETTIGFAPDVGGTLLLAGAPGEAGTHAALTGAHLDGAD
ALFLGLADRYVPSGRLDELTAALENETPEDAVGRFAADPPPSGLAGQRQWIDSCYDSADA
EAIVGRLRAWAGDGSAEASHAADTIEAKSPISVKVTLASLRRVAGMPLDRALAQEYRVGL
RFLAAPDFREGIRAQVVDKDRTPHWKPPTLAEVSPEQVERFLDRWAAANWTSEPVRSMG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaacggccgccacacctgaagcggaagtgctcttcacccggcgcggccggctg
gcggtggcaacgctcaaccggcccaaagccgtcaacgcgctcactgccgggatggtggac
gcattgctgcggcagctcaccgaatgggctgaggacggcagcgtcggcaccgtcctggtg
cagggcgctggcgggcgggggttgtgcgccgggggagacatcgtggcgatttaccgcgac
atcctccggggcggagacgacactgcggatttctggcaggccgagtaccggctgaactac
ctgatctcccggtacccgaaaccttacgtggcactgatggacggccttgtgctgggcggc
ggcgtgggaatctcggcgcacggctcggtccgcgtagtcaccgagcggaccaggaccggc
atgccggagacaaccattggatttgcgcccgacgtcggcgggacgcttctgctggccggc
gcaccaggggaggcgggaacccatgcagccctcaccggcgcccacctcgacggcgcggac
gcgctgttccttggcctggcggaccgctacgtcccgtccggcaggctcgacgaactcacg
gcggcgctggaaaacgaaaccccggaagacgccgtcggacgctttgccgcggacccgccg
ccgtccggacttgccgggcaacggcagtggatcgacagctgctacgactctgcggacgcg
gaagcgatcgtggggcggctgcgggcctgggccggggacggaagcgctgaagcgtcccac
gccgcggacaccatcgaggcgaagtcccccatctccgtcaaagtcaccctggcgtcgctg
cggcgcgtggcgggaatgccgctggaccgggcgctggcgcaggagtaccgggtgggcctg
cggttcctggcggcacccgatttccgggaaggcatccgggcgcaggtggtggacaaggac
cgcactccgcactggaagccgcccaccctggcagaggtatcgccggagcaggttgaacgt
tttttggaccgctgggcagccgcgaactggacctcggaaccggtccggagcatgggctga

DBGET integrated database retrieval system