KEGG   Pseudarthrobacter chlorophenolicus: Achl_1303Help
Entry
Achl_1303         CDS       T00834                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00860  Porphyrin and chlorophyll metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
Module
ach_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Achl_1303
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Achl_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACL39294
UniProt: B8HFF5
Position
complement(1440302..1441465)
Genome map
AA seq 387 aa AA seqDB search
MNALAPAETADATGAAEAAEAQAAESPLEGFRIGVTSHRRSQDLIDALERRGAEVIHAPA
LKIAPVQEDLRLIEDTRTIIAAKPDLCIATTAYGMRRWCEAADTFGIGDQLLETLGACRM
FVRGPKARGAVRAAGLADVGISSDETTATLVDMLLAEGVRGKTVAVQLHGYTDVRQLERL
RMSGATVLTVTPYRWVKPDGADRLPRLIEAACSGNLDVLTFTSAPAVDAMWSTAHEMGVY
KQLIESLKTNVTTAVVGPVTAQPLLDAGVKPLIPERFRMGALIRLVCEHLALNHVRRLDT
RSGNIELRGRSLRIDGQAVELAPAPLLLLRALLGAGGAVLSREALSDLLELRGSVHALDM
TVSRLRSSLPDGKLIETVVKRGYRIRV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacttgcaccggccgaaacggcagacgccaccggggcggctgaggccgcggag
gcccaggcggcagaatcaccgcttgagggcttccgcatcggcgtaacctcgcaccggcgc
tcccaggacctgatcgatgcccttgagcgccgcggcgccgaggtgatccacgccccggcc
ctgaagatcgccccggtccaggaggacctccgcctcatcgaggacacccgcaccatcatc
gcggccaaacctgacctgtgcatcgccaccaccgcctacggcatgcgccgctggtgcgaa
gcggcggatactttcggcatcggcgaccagctgctcgaaaccctgggggcctgccggatg
ttcgtccgcggccccaaggcccgtggcgcggtccgcgcggccggcctcgccgacgtcgga
atcagcagcgacgaaaccaccgcaacgctggtggacatgctgctggccgagggcgtgcgc
ggcaagaccgtcgccgtccagctgcacggctacaccgacgtgcgccagctggagcggctg
cggatgtccggcgccaccgtcctgaccgtcacgccgtaccgctgggtcaagccggacggc
gcggaccgccttccccgcctcatcgaggccgcctgcagcggaaacctggacgtcctcacc
ttcaccagcgcacccgctgtcgacgccatgtggagcaccgcgcacgaaatgggcgtctac
aagcagctgatcgagagcctgaagaccaacgtgactaccgccgtcgtgggccctgtcacc
gcccagccactcctggatgccggcgtgaagccgctgatcccggagcgtttccggatgggc
gcactgatccggctggtctgcgagcacttggcgctgaaccacgtacggcggctggacacc
cggtccggtaacatcgagcttcgcggccgcagcctgcgcatcgacggccaggccgtggaa
ctggcccccgctcccctgctgctgctccgcgccctgctcggcgccggcggggcggtcctg
tcccgcgaggcgttgtccgacctgctggaactgcgcggttcggtgcacgcactggacatg
acagtcagccggctgcgttcctcgctgcccgacggcaagctcatcgaaaccgtggtcaag
cggggctaccggatccgggtctaa

DBGET integrated database retrieval system