KEGG   Pseudarthrobacter chlorophenolicus: Achl_1651Help
Entry
Achl_1651         CDS       T00834                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00260  Glycine, serine and threonine metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_1651
Enzymes [BR:ach01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Achl_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACL39638
UniProt: B8HH49
Position
complement(1860022..1861119)
Genome map
AA seq 365 aa AA seqDB search
MTTTAETGAALRLHDPNVRGFASDNYSGVHPEILAALAAANEGHQVSYGEDDYTSRLHAV
MEEHFGPGIECFPVFNGTGANVLSLQSLLPRWGAVVCASTAHINMDENGAPERIGGMKLL
QVPTPDGKLTPELIDREAWGWGDEHRAQPLAVSITQTTELGTCYTPEEVRAIADHVHAKG
MKLHMDGARLANAAAHLQVPLRAFTRDAGVDILSFGGTKNGLLFGEVVVALNPEAAHGLV
YLRKMNMQLASKMRFMSAQFIALLEGGLWLRSASHANAMASRLRAAVDTIDGVRPTQKTE
SNGVFAVLPEGVADRLRASFRFYDWDEAAREVRWMCSFDTTEEDVDSFIAAIRHELRDYR
GGQAG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacagcagaaacgggtgcggcccttcggctgcacgaccccaacgtgcggggc
ttcgcctcggacaactactccggcgtccatcccgagatcctcgcggcgcttgccgccgcc
aacgaaggccaccaggtgtcctacggcgaggacgactacacgtcccggctgcacgcggtc
atggaagaacatttcgggcccggcatcgaatgcttccccgtgttcaacggaacgggagcg
aacgtcctctcgctgcagtccctgctcccccgctggggagcggtggtgtgcgcatccacc
gcccacatcaacatggacgaaaacggggcaccggaacgcatcggcggcatgaaactgctg
caggtccccaccccggacggaaagctgactccggagctgatcgacagggaggcatggggc
tggggcgacgagcaccgcgcccagccgctggcggtctccatcacccagaccaccgaactg
ggcacgtgctacacaccggaggaagtgcgcgccatcgccgaccatgtccacgccaagggc
atgaagctgcacatggacggtgccaggctggcgaacgccgcagcccacctgcaggtgccg
ctgcgggcgttcacccgggacgccggcgtggacatcctttccttcggcggcaccaagaac
ggcctgctgttcggcgaggtggtggtggcgctgaaccccgaagccgcccatggcctggtg
tacctgcgcaagatgaatatgcaactggcatcgaagatgcgtttcatgtccgcccagttc
atcgccctgctcgaaggcggcctttggctgcgctcggcttcccatgccaacgcgatggcg
tccaggcttcgcgccgccgtggacaccatcgacggcgtccggcccacccagaagacagag
tccaacggggtgtttgccgtgctgcctgagggagtggcggaccggctccgcgcatctttc
cggttctacgactgggacgaagccgccagggaagtgcgctggatgtgctccttcgacacc
accgaagaggacgtggattcgttcattgccgccatccgccacgaactgcgcgactaccgc
ggcgggcaggccggctga

DBGET integrated database retrieval system