KEGG   Pseudarthrobacter chlorophenolicus: Achl_2355Help
Entry
Achl_2355         CDS       T00834                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00260  Glycine, serine and threonine metabolism
ach00750  Vitamin B6 metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01230  Biosynthesis of amino acids
Module
ach_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_2355
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Achl_2355
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Achl_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACL40320
UniProt: B8HB06
Position
complement(2643115..2644221)
Genome map
AA seq 368 aa AA seqDB search
MAHQWRGVIREYADRLPVTASTRVITLGEGGTPLVHAQKLSELTGSEVYLKVEGMNPTGS
FKDRGMTMAMTAAVESGAKAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQ
AIAHGATLLQVDGNFDNCLDIARKLGESYPVFLVNSVNPARIQGQKTGAFEVVDALGDAP
DIHVLPVGNAGNITAYWKGYKEYSAPFESETAGTLPAMSTKTPAMWGFQAAGAAPFVAGH
PITEPDTIATAIRIGNPASWDGAVGARDESGGLIDAVTDDEILAAHRWLSAKEGVFVEPG
SAAGVAGLLKKHAAGEVPSGKTIVITVTGHGLKDPQWALRTEDGSDVQPVKVSNDVVTVA
AELGLEEK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaccaatggcgcggcgtcatccgcgaatacgctgaccgcctgcccgtcacggca
tccacccgggtcatcaccctgggcgaaggcggcactccgctggtgcacgcacagaagctc
tccgagctcaccggctccgaggtgtacctcaaggttgagggcatgaaccccaccggttcc
ttcaaggaccgcggcatgaccatggccatgacggccgccgtcgagtccggtgccaaggca
gtggtgtgcgcctccaccggcaacacctccgcctcggctgccgcctacgcaacggcagcg
ggtctgaagtgcgccgtcctggtgcccgaaggaaagatctccatgggcaagctgagccag
gccattgcgcacggcgccacgctgctgcaggtggacggcaacttcgacaactgcctggac
atcgcccggaagctgggggagtcctaccccgtattcctggtcaactccgtcaaccccgcc
cgcatccagggccagaagaccggagccttcgaggttgttgatgccctcggcgacgccccg
gacatccacgtcctccccgtaggcaacgccggcaacatcaccgcgtactggaagggctac
aaggagtactccgcgccgttcgagtccgaaaccgcgggcacgcttcccgcaatgtccacc
aagacgcctgctatgtggggcttccaggccgctggtgccgcgccgttcgttgccggccac
cccatcaccgaaccggacaccatcgccaccgccatccggatcggcaaccccgcctcctgg
gacggcgccgtgggcgcccgcgacgagtccggcggcctgatcgatgccgtgaccgatgac
gaaatcctggccgcgcaccgctggctgtccgccaaggaaggcgtcttcgtcgagcccggt
tccgctgctggcgttgccggtctgctcaagaagcacgctgccggtgaggttccttcgggg
aagaccatcgtcatcacggtcaccgggcacgggctcaaggatccccagtgggcccttcgc
actgaggacggcagcgacgtccagccggtcaaggtctccaacgatgttgtcactgttgct
gctgaactgggactggaagaaaaatag

DBGET integrated database retrieval system