KEGG   Pseudarthrobacter chlorophenolicus: Achl_2676Help
Entry
Achl_2676         CDS       T00834                                 

Definition
(GenBank) ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ach00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Achl_2676
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ach03011]
    Achl_2676
Ribosome [BR:ach03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Achl_2676
  Bacteria
    Achl_2676
  Archaea
    Achl_2676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ribosomal_L24 KOW SIN1_PH
Motif
Other DBs
NCBI-ProteinID: ACL40641
UniProt: B8HCZ5
Position
complement(2999576..2999938)
Genome map
AA seq 120 aa AA seqDB search
MAAKIKKGDLVQVITGAKAERGGDRGKQGKVLRVFTDTNRVLVEGINRVTKHTRVGQSQR
GTKTGGIEVVEAPIHISNVALVDPSTKKPTRVGFRLDTVEKNGVKKTVRIRVSKSSGKDI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaagatcaagaagggtgacctggttcaggtcatcactggcgccaaggctgag
cgcggcggcgaccgcggcaagcagggcaaggttctgcgcgtcttcaccgacaccaaccgc
gtgctggttgagggtatcaaccgcgtcaccaagcacacccgtgttggacagtcgcagcgc
ggcaccaagaccggcggcatcgaggtcgtagaggccccgatccacatttccaacgtggcc
ctggttgacccgtcgaccaagaagccgacccgtgtgggcttccgcctcgacactgtggag
aagaacggtgtcaagaagaccgtccgtatccgcgtgtccaagagctccgggaaggacatc
taa

DBGET integrated database retrieval system