KEGG   Pseudarthrobacter chlorophenolicus: Achl_2787Help
Entry
Achl_2787         CDS       T00834                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00071  Fatty acid degradation
ach00350  Tyrosine metabolism
ach00625  Chloroalkane and chloroalkene degradation
ach00626  Naphthalene degradation
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_2787
  Lipid metabolism
   00071 Fatty acid degradation
    Achl_2787
  Amino acid metabolism
   00350 Tyrosine metabolism
    Achl_2787
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Achl_2787
   00626 Naphthalene degradation
    Achl_2787
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Achl_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACL40752
UniProt: B8HDN4
Position
complement(3108568..3109590)
Genome map
AA seq 340 aa AA seqDB search
MTTTMQAAVVNTFGTDLQVQELPIPTPGPGEALVKVLTTGVCHTDLHAAEGDWPVKPTPP
FVPGHEGVGEVVALGEGVTDLAVGDMVGNAWLWSACGDCQYCRTGWETLCEAQKNGGYSV
DGSFGEYMLVNTRYAARIPAGSDPVEVAPVLCAGVTVYKGLKMTEAQPGQWVTISGIGGL
GHIAVQYAVAMGLRVAAVDIADDKLALAKAHGAALTVNALHEDPAEVIQRETGGCHGVLV
TAVHPSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEAL
DFYAQGKIHPTVSVRELSEVNAVFDEMKHAKIDGRVVLRF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacaatgcaagcagcagtggtcaacactttcggtaccgacctgcaggtccag
gaactgcccatccctacccccggcccgggggaggccctcgtgaaggtcctcaccaccggc
gtctgccacaccgatctccatgccgcggaaggcgactggcccgtcaagccaacgccgccg
ttcgtgcccggccatgaaggcgtcggtgaggtggtggcactcggcgaaggcgtcaccgac
ctcgccgtcggggacatggtgggcaatgcctggctgtggtccgcctgtggcgattgccag
tattgccgcaccggctgggagaccctgtgcgaggcacaaaagaacggcggctacagcgtg
gacgggtcctttggcgagtacatgcttgtcaacacccggtacgccgcccgcataccggcg
ggatccgaccccgtcgaggtggcgccggtgctctgcgccggcgtcaccgtctacaagggc
ctgaagatgacggaggcgcagcccggccagtgggtcaccatctccgggatcggcgggctg
ggacatattgccgtgcagtacgccgttgccatgggcctccgggtggcagccgtcgacatc
gccgatgacaagctcgccctggccaaggcccacggtgcggccctgacggtcaatgccctg
cacgaagatccggcggaggtgatccagcgcgagacaggaggttgccatggagtgctggtt
accgcggtgcacccttcagcgttcgggcaggccatcggtatggcccgccgcggcggcacc
attgtgttcaacgggctgccgccgggcgacttcccggcgccgatcttcgagattgtgctc
aagggcctgaccgtccgcggttccatcgtgggtacccggcaggacctggaggaggccctg
gacttctacgcccaggggaagatccaccctaccgtctcagtccgggaactgtccgaggtc
aacgcggtcttcgatgagatgaagcacgccaagatcgacggccgcgtggtcctgaggttc
tga

DBGET integrated database retrieval system