KEGG   Pseudarthrobacter chlorophenolicus: Achl_3168Help
Entry
Achl_3168         CDS       T00834                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00620  Pyruvate metabolism
ach00640  Propanoate metabolism
ach00680  Methane metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_3168
   00620 Pyruvate metabolism
    Achl_3168
   00640 Propanoate metabolism
    Achl_3168
  Energy metabolism
   00680 Methane metabolism
    Achl_3168
Enzymes [BR:ach01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Achl_3168
Lipid biosynthesis proteins [BR:ach01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Achl_3168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACL41129
UniProt: B8HFT6
Position
3522635..3524647
Genome map
AA seq 670 aa AA seqDB search
MSQDTPSSTATVPAAPAGQGAQQGDAFENLLHETRTFPPTPEFAANAVVKAGEYAEADAD
RPAFWAKQARELLTWSKDFDEALDWSNPPFAKWFVGGEVNAAYNALDRHVENGLGDRVAI
HFEGEPGDSRSYTYAELTEEVKKAANAFESLGVSKGDRVAVYLPMIPEAVITLLACARIG
AVHSVVFGGFSADALRSRIDDAEAKLVVTADGTYRRGKPSALKPAVDDALSQDGHTVQNV
VVVKRNGQDVDWHEGRDHWWDETVGEASAEHTAVGHDSEHPLFILYTSGTTGKPKGILHT
TGGYLTQTAYTHKAVFDLHPETDVYWCTADVGWVTGHSYVTYAPLINGATQVMYEGTPDS
PHQGRWWEIVEKYKVSILYTAPTAIRTFMKWGRDIPDKYDLSSIRVLGSVGEPINPEAWM
WYRTVIGGDNAPIVDTWWQTETGAQMIAPLPGVTAAKPGSAQVPLPGIAVDVVDEMGESV
PDGHGGFLVIREPWPAMLRGIWGDPERFKDTYWSRFETMYFAGDGAKKDEDGDIWLLGRV
DDVMNVSGHRLSTTEIESALVSHPAVAEAAVVGASDETTGQAVVAFVILRGDAANNGDET
VQELRNHVGKEIGPIAKPKNILVVPELPKTRSGKIMRRLLKDVAEGRDPGDATTLADPTI
MQQIAQSLRK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggacactccaagctccacggccaccgttcccgctgccccggcaggacagggt
gcacagcagggcgacgccttcgaaaacctgctgcatgagaccaggaccttcccgcccacg
ccggagttcgcggccaacgcagtggtcaaggccggtgaatatgcagaggccgacgccgac
cggccggctttctgggcgaagcaggcccgcgagctgctcacctggagcaaggacttcgac
gaggctttggactggtccaacccgccgttcgccaagtggttcgtgggcggcgaagtcaac
gccgcgtacaacgcgctggaccggcacgtggaaaacggcctgggcgaccgcgtcgccatc
catttcgaaggcgaacccggtgacagccgcagctacacctacgcggagctgaccgaggaa
gtaaagaaggccgcgaacgcgttcgaatccctcggcgtgtccaagggcgaccgtgtggct
gtttacctgcccatgatccccgaggcggtcatcaccctgcttgcctgcgcacggatcggc
gcggtccactccgtggtgttcggcggcttctccgccgacgccctgcgctcccgcatcgac
gacgctgaagcaaagctggtggtcaccgctgacggaacctaccgccgcggcaagccgagt
gcgctgaagccggctgttgacgacgccctgtcccaagatgggcacaccgtccagaacgtg
gtggtggtcaagcgcaacggccaggacgtggactggcacgagggccgcgaccactggtgg
gacgaaaccgtcggtgaagcgtccgccgagcacaccgccgtcgggcacgactccgagcac
ccgctgttcatcctctacacctccggcaccaccggcaagcccaagggcatcctgcacacc
accggcgggtacctcacccagaccgcgtacacgcacaaggcggtgttcgacctgcacccg
gagacggacgtgtactggtgcacggccgacgtcggctgggtcaccgggcactcctacgtc
acctacgccccgctcatcaacggtgccacccaggtcatgtacgagggcaccccggactcc
ccgcaccagggccgctggtgggagatcgtggaaaagtacaaggtctccatcctgtacacc
gcccccaccgccatccgcacgttcatgaagtggggccgggacatcccggacaagtacgat
ctgtcctccatccgggtcctcggctccgtgggtgagcccatcaaccccgaggcgtggatg
tggtaccggacggtcatcggcggggacaatgcgcccatcgtggacacctggtggcagacc
gaaaccggcgcacagatgatcgccccgcttcccggcgtcaccgcggcgaagccgggctcc
gcgcaggtgccgctaccgggcatcgccgtggacgtcgtggacgaaatgggcgaatcggtg
cccgacgggcacggcgggttcctggtgatccgtgaaccctggccggccatgctccgcggc
atctggggcgatcccgaacggttcaaggacacctactggtcacggttcgagaccatgtac
ttcgccggggacggcgccaagaaggacgaggacggcgacatctggctcctcggccgggtg
gatgacgtcatgaacgtctccgggcaccgcctctccaccacggaaatcgagtccgccctg
gtctcccaccccgccgtggccgaagccgccgtcgttggcgcctctgacgagaccaccggc
caggccgtggtggctttcgtcatcctgcgcggcgacgccgcgaacaacggcgatgaaacc
gtccaggaactccgcaaccacgtgggcaaggagatcggacccatcgccaagcccaagaac
atcctggtggtccctgaactgcccaagacccgctccggcaagatcatgcggcgcctgctc
aaggacgtcgccgagggccgcgacccgggcgacgccaccacactggccgatcccacgatc
atgcagcagatcgcacagtcgctcagaaagtaa

DBGET integrated database retrieval system