KEGG   Pseudarthrobacter chlorophenolicus: Achl_3242Help
Entry
Achl_3242         CDS       T00834                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ach  Pseudarthrobacter chlorophenolicus
Brite
KEGG Orthology (KO) [BR:ach00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Achl_3242
Enzymes [BR:ach01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Achl_3242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACL41203
UniProt: B8HG10
Position
3602762..3603556
Genome map
AA seq 264 aa AA seqDB search
MRLAVAQIISSADTAANLELIRDYATQAKAAGAELVVFPEAAMRAFGHSLTEIAEPLDGP
WADKVRTIANELDIAIVAGMFTPGKDGRVRNTLLVTAPGLDTSYDKVHLFDAFGFTESKT
VDAGQRPVTFELNGTVFGLATCYDVRFPALFTANARAGAQVNIVCASWGAGEGKAEQWDL
LVRARALDSTTFVVACGQGDPETIGAGPAGSAPTGIGHSAVISPLGSALVALGGKPELAV
VDVDPAIVDDVRTKLPVLANARQF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgcagtcgcccaaatcatcagcagcgccgatacggcagccaacctggagctc
atccgggactacgcaacacaggctaaggcggccggcgcggagctggtggttttccccgaa
gccgccatgcgtgccttcggccattcgctgaccgaaatcgcagagccgctggacggcccg
tgggcggacaaggtccgcaccatcgccaacgaactggacattgcgatcgtagccgggatg
ttcacgcccgggaaagacggacgcgtccgcaacaccctcctggtcaccgcgcccggtctg
gatacctcctacgacaaggtgcacctgtttgatgccttcggtttcaccgagtccaaaacg
gtcgacgccggccagcgccccgtgacgtttgagctcaacgggacggtcttcggccttgcc
acctgctacgacgtccgcttcccggcgctcttcacagccaacgcccgcgccggggcacag
gtgaacatcgtctgcgcttcctggggtgccggcgagggcaaggcagagcagtgggacctc
ctggtgcgcgccagggccctggacagcaccaccttcgtggtggcttgcggccagggcgac
cccgaaaccatcggcgccgggcccgccggcagcgcccccaccggaatcggccacagcgcc
gtcatctctccgctgggcagcgccctggtagcgctgggcggaaagccggaactcgccgtc
gtggacgtcgatcccgccatcgttgacgacgtccgcaccaagctgcccgtcctggccaac
gcccgccagttctag

DBGET integrated database retrieval system