KEGG   Pseudarthrobacter chlorophenolicus: Achl_3587Help
Entry
Achl_3587         CDS       T00834                                 

Definition
(GenBank) amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00860  Porphyrin and chlorophyll metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Achl_3587
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Achl_3587
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Achl_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 GIDA Lycopene_cycl Thi4 HI0933_like Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACL41543
UniProt: B8H6L7
Position
complement(3988425..3989810)
Genome map
AA seq 461 aa AA seqDB search
MKDAVIVGGGLAGLSAAWRLRHWDTVVLESGTRVGGRIRSERRGDYWLNWGGHVFAGAGS
STDALLNEVGVMAVQIPGSLQGLSMNGKFIKKGHIATYPFRIPMSLAARVDTMRAGLKVV
SGVAKYTGVVRKRIGESGAMRQQRIYDFENSTSFQDFVGNLSEDAAALFKTTVTRSAGDM
DQISAGAGIGYFSLVLGFGQGLSQGIVGGPSTLTESIAAALGDRIELGAVVQEVVHKKDS
VLVRYRQDGVDREVEARTVVLATTADVSHKIGVDLPEELRGALDQIKYGPHVSTAFLTNE
TTAKPWDDIYAIAAPKRSFAIALNQASIVRGTESVRKPGGSFMTFSPASLGKALLEKPEE
EVINTHLTDLDQVLGHGFAGSVVEAKVDRWKNASPYCFPGRAKIQSTLMRGTDRVFLAGD
YLGTLYTESSITTGFSAAQEAASVLATHRQAPPLSGLSIVA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgcagtaatcgttggcggcggactcgccggcctctcggcggcctggcggctg
aggcactgggacacagtggtcctggaatcgggcacccgggtgggcggacgcatccgttcc
gaacggcgcggtgactactggctgaactggggcgggcacgtcttcgccggcgccggttcc
tccacggatgccctgctcaacgaagtcggcgtgatggccgtccagatccccggttccctg
caggggctgtccatgaacggcaagttcatcaagaagggacacatcgccacctaccccttc
cgcatccccatgtccctggccgcccgcgtcgacaccatgcgtgccggcctgaaggtggtc
agcggagtggccaagtacaccggcgtggtgcgcaagcgcatcggcgaatcaggtgccatg
cgccagcagcggatctacgacttcgagaacagcacctccttccaggacttcgtgggcaac
ctgtccgaggacgccgccgccctgttcaagaccacagtgacccggtccgccggtgacatg
gaccagatctccgccggcgccggcatcggctacttcagcctggtcctcggtttcggccag
gggctcagccagggcatcgtgggcggaccgtccaccctgaccgaatccattgccgcggca
ctgggcgaccgcattgagctcggcgcggtggtgcaggaagtagtccacaaaaaggattcc
gtgctggtccggtaccgccaggacggcgtcgaccgcgaagtggaggcccgcaccgtggtc
ctggccaccactgccgacgtctcgcacaagatcggcgtggacctgcccgaggagcttcgc
ggggcgctggaccagatcaagtacggtccgcacgtcagcaccgccttcctcacgaacgaa
accaccgcaaagccgtgggatgacatctacgccatcgccgcccccaagcgctccttcgcg
attgccctaaaccaggcgagcatcgtgcgcggcaccgaatccgtccgcaagcccggcggc
agcttcatgaccttctcacccgccagcctcggcaaggccctgctggagaagcccgaggag
gaggtcatcaacacccacctgaccgatttggaccaggtccttggccacggcttcgcgggc
agtgtggtggaggccaaggtggaccggtggaagaacgcctcaccgtattgcttcccgggc
cgggcaaagatccagtccaccctgatgcgcggaaccgaccgcgtcttcctggccggcgac
tacctgggcaccctgtacaccgaaagctccatcaccaccggcttctccgcagcccaggag
gctgccagcgtcctggcaacgcaccggcaggcaccgccgctctccggcctgtccatcgtc
gcctga

DBGET integrated database retrieval system