KEGG   Pseudarthrobacter chlorophenolicus: Achl_4573Help
Entry
Achl_4573         CDS       T00834                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K21726  4-nitrophenol 2-monooxygenase / 4-nitrocatechol 4-monooxygenase, oxygenase component [EC:1.14.13.29 1.14.13.166]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00627  Aminobenzoate degradation
ach01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ach00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Achl_4573
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.29  4-nitrophenol 2-monooxygenase
     Achl_4573
    1.14.13.166  4-nitrocatechol 4-monooxygenase
     Achl_4573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB DUF1686
Motif
Other DBs
NCBI-ProteinID: ACL42524
UniProt: B8HJC6
Position
pACHL02:86616..88223
Genome map
AA seq 535 aa AA seqDB search
MRTGKEYLESLRDGRKVYVGGELIEDVTTHPKTKGYAQAIAEYYDLHLKPENQDLLTFVD
ENGKRESMHWFLPRSKEDVIKRRNYADFIFRHFQGGIFTRPPAGMNVVMFTQVDDQEPWA
ENSRFKNGHRDLSGNIQRHWDEVTAKDLAVSPMFVDVQYDRGRDDSMAETPMLSIIEEND
EGIVVRGWKAIGTSIPFVNNLLIGNLWRPGQTAEQTIYAMVPLATPGVSVVARESRAQPD
ADPYDRPLATLGDELDGMVYFDDVLITWDQVQHVGNPEHAKWYPQRQFDWVHLETQIRQT
VHAELMVGLGLLITQALGTSKNPVVQSQLAELIRFRETCRAFMIAAEETGFHTPGGLYKP
NNIFIDFGRAHYLEHQHEFVNMLIEFCGRGIVIQPTKRELDHPYIGPKLQEALRGSEISA
RDRIKIFRQISERFLTEFGSRHEMFEKFNGTPPYLINILTMQRTEYQVDGPLTQLARDVL
GFGDTAELGRRAEEAEKASHYASVKYQPEYARSQDVHDGYIENAESSDPAVTTPA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaggacaggaaaagaatacctggagtctcttcgcgacggacgcaaagtctatgtcggc
ggagagctcattgaggatgtaacgacgcatcccaagacaaagggttatgcccaggcaata
gccgaatactacgaccttcatctcaagccggagaaccaggacctcctgacgttcgtcgac
gagaacggcaaacgcgaatcgatgcactggttcttgccgcgctcaaaggaagacgtcatc
aagcgtcgtaactacgccgacttcattttccggcacttccagggcggcatcttcacccga
ccgccggcagggatgaacgtcgtcatgttcacccaggtggacgaccaggaaccatgggcg
gaaaactccaggtttaagaacggccaccgtgacctgtccggcaacatccagcgccactgg
gacgaagtcaccgccaaggacctggcggtctcgccaatgttcgtcgacgtgcagtacgac
cggggccgcgatgactcaatggccgaaacgcccatgctcagtatcatcgaggaaaacgat
gaaggtatcgtcgtgcgaggctggaaagccatcggaacctcgatcccgttcgtaaacaac
ctgctgatcggtaacctgtggcggcccggccagacagccgaacaaaccatctacgccatg
gtgccgctggccacacccggcgtgagcgtcgttgcccgcgaatcccgcgcccaacctgat
gcggatccttacgatcgtccgttggcaacactgggagacgagctcgacggcatggtctat
tttgacgatgttctcattacttgggaccaggtgcagcacgtcggaaacccggaacacgcg
aagtggtacccccagcggcagttcgactgggtacacctcgagacccagatccgtcagaca
gtgcacgcagagctgatggtcggccttggcctgctcatcacccaggctcttggaaccagc
aagaaccccgtggtccagtctcagctggcagagctcatccgcttccgcgagacgtgccgg
gcgttcatgatcgctgcagaagagacgggcttccacacccccggtggcctgtataagccc
aacaacatcttcattgacttcggccgggcacactatctcgagcaccagcacgagtttgtc
aacatgctcatcgagttctgcggccgcggcatcgttattcagcccaccaagcgcgagctt
gatcacccttacattggaccgaaacttcaggaagcccttcgcggctccgagatcagcgcc
cgcgatcgaatcaagatcttccgtcaaatcagtgaacgcttccttaccgaattcggtagc
aggcacgagatgtttgaaaagttcaacggtactccgccatacctgatcaacatcctcacg
atgcagcgcaccgagtatcaggttgacggacccctgacacagctggcacgagatgtcttg
ggctttggcgatacggccgagcttggcaggcgagcagaagaggccgaaaaggcttcgcac
tacgcgagcgtcaagtaccagcccgaatacgcacgctcccaggacgtgcacgacggctac
atcgagaacgccgaatcaagtgaccctgcggtaaccacgccggcctaa

DBGET integrated database retrieval system