KEGG   Achromobacter sp. B7: DVB37_01335Help
Entry
DVB37_01335       CDS       T05703                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
achb  Achromobacter sp. B7
Pathway
achb00010  Glycolysis / Gluconeogenesis
achb00071  Fatty acid degradation
achb00350  Tyrosine metabolism
achb00625  Chloroalkane and chloroalkene degradation
achb00626  Naphthalene degradation
achb00680  Methane metabolism
achb01100  Metabolic pathways
achb01110  Biosynthesis of secondary metabolites
achb01120  Microbial metabolism in diverse environments
achb01130  Biosynthesis of antibiotics
achb01200  Carbon metabolism
achb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DVB37_01335
  09102 Energy metabolism
   00680 Methane metabolism
    DVB37_01335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DVB37_01335
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DVB37_01335
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DVB37_01335
   00626 Naphthalene degradation
    DVB37_01335
Enzymes [BR:achb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DVB37_01335
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     DVB37_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C Met_10
Motif
Other DBs
NCBI-ProteinID: AYD62688
Position
complement(284409..285518)
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAFGPGKPLEIVEIDVAPPQRGEVLVQITHTGVCHTDAFTLSGDDPEGLFPAVL
GHEGAGVVVEVGEGVTSLKPGDHVIPLYTAECRECKFCLSGKTNLCQKVRATQGKGVMPD
GTSRFSYEGKPLYHYMGCSTFSEYTVVNEISLAKINPAAPHEKVCLLGCGVTTGLGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRIIAVDTNPNKFVLASAMGATDCINPKD
YDKPIQDVIVELTDGGVDFSFECIGNVHVMRAALECCHKGWGESIIIGVAGAGQEISTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMSGKIDLDPFVTHTLPLDRINEAFDLMHEG
KSIRTVIHF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgcgcagcagtcgcattcggacccggcaagccgctggaaatcgttgaaatc
gacgtcgcgcccccgcagcgcggcgaagtgctggtgcagatcacgcacaccggcgtctgc
cacaccgacgcgttcacgctcagcggcgacgaccccgaaggcctgttccccgccgtgctg
ggccacgaaggcgcgggcgtggtcgtggaagtgggcgaaggcgtgacgtcgctgaagccc
ggcgaccacgtcattccgctctacacggccgaatgccgcgaatgcaagttctgcctgtcc
ggcaagaccaacctgtgccagaaggtgcgcgccacccagggcaagggcgtcatgcccgac
ggcacctcgcgcttcagctacgaaggcaagccgctgtaccactacatgggctgctcgacc
ttcagcgaatacacggtcgtcaacgagatctcgctggccaagatcaacccggccgccccg
catgaaaaggtttgcctgttgggctgcggcgtgaccaccgggctgggcgccgtgcacaac
accgcgaaggtcaaggaaggcgacaccgtcgccgtgttcggtctgggcggcatcggcctg
gccgtgatccagggcgcggtgcaggccaaggccggccgcatcatcgccgtggacaccaac
ccgaacaagttcgtgctggccagcgccatgggcgccaccgactgcatcaacccgaaggac
tacgacaagcccatccaggacgtcatcgtcgaactcaccgacggcggcgtggacttctcg
tttgaatgtatcggcaatgtgcacgtgatgcgcgccgcgctggaatgctgccacaagggc
tggggcgaaagcatcatcatcggcgtggccggcgccggccaggaaatcagcacgcgcccg
ttccagctggtcacgggccgcgtgtggcgcggatcggccttcggcggcgtgaagggccgc
acgcaactgccgggcatggtcgaagacgcgatgagcggcaagatcgacctggacccgttc
gtcacgcacacgctgccgctggatcgcatcaacgaagccttcgacctgatgcatgaaggc
aagtcgatccgcaccgtgatccacttctaa

DBGET integrated database retrieval system