KEGG   Achromobacter sp. B7: DVB37_01585Help
Entry
DVB37_01585       CDS       T05703                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
achb  Achromobacter sp. B7
Pathway
achb00450  Selenocompound metabolism
achb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DVB37_01585 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:achb03016]
    DVB37_01585 (selD)
Enzymes [BR:achb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     DVB37_01585 (selD)
Transfer RNA biogenesis [BR:achb03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    DVB37_01585 (selD)
 Prokaryotic Type
    DVB37_01585 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AYD62728
Position
339825..340886
Genome map
AA seq 353 aa AA seqDB search
MTHDVASAAVPRLTSLSHGGGCGCKIAPGVLSELLKRFGPAASYPNLMVGTETADDAAVY
RLNDEQALIATTDFFMPIVDDPHDFGRIAATNALSDVYAMGGTPIMALAIVGMPINVLPH
SVIADILRGGESVCAEAGIPVAGGHSIDSVEPIYGLAVMGLVHPSRVKRNADARAGDVLI
LGKALGVGILSAALKKNQLDEAGYRVMIDTTTRLNRPGAALAALDGVHAVTDVTGFGLLG
HALEMARGAKLTARLDLDALPWLPGVEAFASQGVITGASGRNWASYGNAVQLSAGVTDAQ
RALLTDPQTSGGLLVSCAPEVADAVLALFREQGFDHATVVGEMIAGDGQVQVG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgatgtagcgtccgcggcagtgccgcgtttgacttcgctttcgcacggaggc
ggctgcggctgcaagatcgcgccgggcgttctgtccgaactgctcaagcgtttcggcccc
gccgccagctaccccaacctgatggtgggcaccgagaccgccgatgacgcggcggtgtac
cggcttaatgacgagcaggcgctcatcgccacgaccgatttcttcatgcccatcgttgac
gacccgcacgacttcggccgcatcgccgcgaccaacgcgctgtcggacgtctatgcgatg
ggcggcacgccgatcatggcgctggccatcgtgggcatgccgatcaatgtgctgccgcac
agcgtcatcgcggacattctgcgcgggggcgaatcggtctgcgccgaagcgggcattccg
gtggcgggcggccacagcattgattcggtcgaacccatctatggcctggcggtgatgggc
ctggtgcatcccagccgcgtcaagcgcaacgccgatgcgcgtgcgggcgacgtgctgatc
ctgggcaaggcgttgggcgtgggcatcttgtcggccgcgctgaaaaagaaccagctggac
gaagccggctaccgcgtcatgatcgacacgacaacccgcttgaaccggcccggcgccgcg
ttggccgcgctggacggcgtgcacgcggtgaccgacgtcacgggctttggcttgctgggc
cacgcgctggaaatggcgcgcggcgcaaaactgaccgcgcgccttgacctggatgcgttg
ccctggctgcccggcgtggaagcgtttgcttcccagggcgtcatcacgggcgcatcgggc
cgcaattgggcgtcatacggcaacgccgtgcagctgtccgcgggcgtcaccgacgcgcag
cgcgccttgctgaccgatccgcaaacctcgggcggcctgctggtgtcctgcgcgccggaa
gtggccgacgcggtgctggcgctattccgtgagcagggctttgaccacgcaaccgtcgtg
ggcgagatgatcgcgggtgacgggcaagtgcaggttggctga

DBGET integrated database retrieval system