KEGG   Achromobacter sp. B7: DVB37_13105Help
Entry
DVB37_13105       CDS       T05703                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
achb  Achromobacter sp. B7
Pathway
achb00564  Glycerophospholipid metabolism
achb01100  Metabolic pathways
achb01110  Biosynthesis of secondary metabolites
Module
achb_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DVB37_13105 (psd)
Enzymes [BR:achb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     DVB37_13105 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AYD64753
Position
complement(2897269..2898138)
Genome map
AA seq 289 aa AA seqDB search
MTIKEQLFLASQYLAPHHLVSRFFGYASDCREPAVKNWMISRFVRKYGVDMREALQEDPL
AYDCFNDFFTRALKDDARPLDDEPGSVLCPADGAISQLGAIEQGRIFQAKGHSYGLVDLL
GGDVERAAPFQGGEFATVYLSPKDYHRVHMPVAGTLREMIHVPGRLFSVNPLTARNVPRL
FARNERVVCIFDTEHGPMALVLVGAMIVASIETVWAGLVTPYKRRVKAVRYDAAARAPIH
LEKGAEMGRFKLGSTAIVLFGPDQIRWADTPSVLGPVRMGELLALPKHR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaaagaacaactatttctcgccagccagtatcttgcgccccatcacctggtg
tcgcgcttcttcggatacgcctcagactgccgggaacccgcggtcaagaactggatgatt
tcgcgctttgtccgcaagtatggcgtcgacatgcgcgaagcgctgcaagaagacccgttg
gcctacgactgcttcaatgacttcttcacgcgcgcgctgaaagacgacgctcgcccgctg
gacgacgaacccggttccgtgctctgtccggccgacggcgcgatcagccagttgggcgcc
atcgagcaaggccgcattttccaggccaaaggccacagctacggcctggttgacctgctg
ggcggcgacgttgagcgagccgcgccgtttcaaggtggcgaatttgccacggtctacctg
tcgcccaaggactatcaccgcgtgcacatgccggtggccggcacgctgcgcgaaatgatc
catgtgcctggccgcttgttctcggtcaacccactgacggcgcgcaacgtgccgcgcctg
ttcgcgcgcaacgaacgcgtggtctgcatctttgataccgagcatggtccgatggcgctg
gtgctggtgggtgcgatgatcgttgcgtcgatcgaaaccgtgtgggccggcctggtcacg
ccctataagcgccgagtaaaagcggtgcgctatgacgccgccgcgcgcgcgccgattcat
ctggaaaaaggcgcggaaatgggccggttcaagctggggtccaccgccatcgtattgttc
ggcccggaccagatccggtgggccgacacgccgtcggtgctgggcccggtgcgcatgggc
gaactgctggccctgcccaagcatcgttga

DBGET integrated database retrieval system