KEGG   Achromobacter sp. B7: DVB37_19410Help
Entry
DVB37_19410       CDS       T05703                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
achb  Achromobacter sp. B7
Pathway
achb00051  Fructose and mannose metabolism
achb01100  Metabolic pathways
achb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DVB37_19410
Enzymes [BR:achb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     DVB37_19410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AYD65843
Position
complement(4306446..4307228)
Genome map
AA seq 260 aa AA seqDB search
MTDTMHLGKEELIARAQAEMQRQFDTPQWSLRERLALTCRILFDGGHDSGLAGQITARTP
EAGRYYTQRLGLGFDEITASNLLVVDEDLRVQEGGGMPNPANRFHSWIYRARPDVNCIIH
THPLHVASLSMLEVPLEVSHMDNCTLYDDVAFLKDWPGVPVGNEEGEIISAALADKRAIL
LSHHGMLIAAGSVEEACVLALQFERAARMQLLAMSAGKIQPIPPALGREAHDWILTPKRS
QVGFSYYARRALRAHPDVLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgatgcacctgggaaaagaagaactgatcgcgcgtgcgcaagccgagatg
cagcgccagttcgatacgccgcaatggagcttgcgcgaacggctggcgctgacgtgccgc
atcttgttcgatggcggccacgattccgggctggcggggcagatcaccgcgcgtacgccc
gaagcggggcgctattacacgcagcggctgggcctgggctttgatgaaatcacggccagc
aatctgttggtggtggatgaagatttgcgtgtgcaagagggcggcggcatgcccaacccg
gccaaccgttttcattcgtggatctatcgcgcgcgccccgatgtgaattgcattatccac
acgcaccccttgcacgtggcgtcgctgtcgatgctggaggtgccgctggaggtgtcgcac
atggacaactgcacgctgtacgacgatgtggcttttctgaaggactggccgggcgtgccg
gtgggcaatgaagaaggcgagatcatctcggcggcgctggccgacaagcgggcgattctg
ttgtcgcaccacggtatgttgattgcggccgggtcggtggaagaggcctgcgtgctggcc
ttgcagttcgaacgcgcggcgcgcatgcagttgctggcgatgtcggcgggcaagatccag
cctattccgcccgcgctgggacgcgaagcgcatgactggatcctgacgcccaagcggtcg
caggtggggttttcgtattacgcccgccgggcgctgcgcgcgcatccggacgtgttgtcg
tag

DBGET integrated database retrieval system