KEGG   Achromobacter sp. B7: DVB37_27435Help
Entry
DVB37_27435       CDS       T05703                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
achb  Achromobacter sp. B7
Pathway
achb00620  Pyruvate metabolism
achb00630  Glyoxylate and dicarboxylate metabolism
achb01100  Metabolic pathways
achb01110  Biosynthesis of secondary metabolites
achb01120  Microbial metabolism in diverse environments
achb01200  Carbon metabolism
Module
achb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:achb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DVB37_27435
   00630 Glyoxylate and dicarboxylate metabolism
    DVB37_27435
Enzymes [BR:achb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DVB37_27435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AYD67246
Position
6061427..6063607
Genome map
AA seq 726 aa AA seqDB search
MTQRTQQHGLQVAANLTQFIEQEALPGTGLDADSFWQGFAALVHDLAPKNRALLAERDRL
QAELDAWHRANPGPIADPAAYRKFLESIGYLLPQPASVQATTDNVDTEISQQAGPQLVVP
MSNSRYALNAANARWGSLYDALYGTDAIPATPGDTGKGYNPERGAAVIARARSFLDTAAP
LANGSHADAQSYTVEGDQLRVNLAKGVVTSLKFGSQFAGYQGDASAPTAILLKNNGLHFE
IQIDRANAIGSTDAAGVKDVLVEAALTTIMDCEDSVAAVDADDKVHIYRNWLGLMKGDLT
EAVTKAGKTFTRKLNADRQYTRPDGSALTLHGRSLMFVRNVGHLMTNPAILDRDGQEIPE
GILDAVVTSLAALHDRTAKLNSRTGSVYIVKPKMHGPAEAAFASELFDRVEDLIKVPRNT
LKMGIMDEERRTSINLKACIGAAASRVAFINTGFLDRTGDEMHSSMEAGPMLRKGDMKST
AWITAYERNNVLVGLDTGLRGRAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPT
AATLHALHYHQIDVQAVQKELERTKLDSVRDDLLGGLLSVPVGDPSKWSAADIQQELDNN
VQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLRHGVTNKEQVTET
FKRMAKVVDGQNAGDPLYQPMAGNFDTSLAFKAACALVFEGLTQPNGYTEPLLHKYRLQF
KAAAQA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacgcacccagcaacacggcctgcaagtggcggccaatctcacccaattcatc
gaacaggaagccctgcccggcaccggcctggatgcagacagcttctggcagggttttgcg
gcgctggtacatgacctggcgcccaagaaccgcgccctgctggccgaacgcgaccgtctg
caagccgagctcgacgcctggcaccgcgccaaccccggccccatcgccgacccggccgcc
taccgcaagtttctggaaagcatcggctacctgctgccccaaccggcaagcgtgcaagcc
accaccgacaacgtcgataccgaaatctcgcagcaggccggtccgcagctggtcgtgccg
atgtccaactcccgctatgcattgaatgccgccaacgcacgctggggcagcctgtacgac
gcgctttacggcaccgacgccatccccgccacgcccggcgatacgggcaagggctacaac
cccgagcgcggcgccgcggtcattgcgcgcgcacgcagctttctggacacggccgccccg
ctggccaatggctcgcacgccgatgcgcaaagctacaccgttgaaggcgatcaactgcgc
gtcaacctggccaagggcgtggtcaccagcctgaaattcggctcgcaattcgccggctac
caaggcgacgcgtcagcccccacggccatcttgctcaagaacaacggcctgcactttgaa
atccagatcgatcgcgccaacgccatcggcagcaccgacgccgcgggcgtgaaagacgtg
ctggtcgaagccgcgctgaccaccatcatggactgcgaagactcggttgccgccgtcgac
gccgacgacaaggtgcacatctatcgcaactggctgggcctgatgaagggcgacctgacc
gaagccgtcactaaggccggcaaaaccttcacgcgcaagctgaacgccgaccgccagtac
acgcgtccggacggcagcgcgctgaccttgcacggccgctcgttgatgttcgtgcgcaac
gtgggccacctgatgaccaacccggccattcttgaccgcgacggccaggaaatccccgaa
ggtattctggacgccgtcgtcaccagcctggccgcgctgcacgaccgcaccgccaagctg
aattcgcgcaccgggtccgtctacatcgtgaagcccaagatgcacggcccggccgaagcg
gccttcgccagcgaattgttcgaccgcgtcgaagacctgatcaaggtgccgcgcaacacc
ctgaaaatggggatcatggatgaagagcgccgcaccagcatcaacctgaaagcgtgcatc
ggcgccgccgcatcccgcgtggcgttcatcaacacgggcttcctggaccgcaccggcgac
gagatgcactccagcatggaagcgggcccgatgctgcgcaagggcgacatgaagtccacc
gcctggatcaccgcctacgaacgcaataacgtgctggttggcctggacacgggcctgcgc
gggcgcgcccagatcggcaagggcatgtgggccatgcccgacctgatggccgccatgctg
gaacagaaaatcgcccacccgaaggccggcgccaacaccgcctgggtcccctcgcccacc
gccgccacgctgcacgcgctgcactatcaccagatcgacgtgcaagcggtgcaaaaggaa
ctggaacgcaccaagctggacagcgtgcgcgacgacttactgggcgggctgttgagcgtg
ccggtgggcgatccgtccaagtggtccgccgccgacatccagcaggagctggacaacaac
gtgcagggcatcctgggatacgtcgtgcgctggatcgaccagggcgtgggttgctcgaag
gtgcccgacatccataacgtcggtctgatggaagaccgcgccacgctgcgcatttccagc
cagcacatcgccaattggctgcgccacggcgtgaccaacaaggaacaggtcacggaaacc
ttcaagcgcatggccaaggtcgttgatggccagaacgccggcgacccgctctaccagccg
atggccggcaatttcgacacgtcgctggccttcaaggcggcctgcgcactggtgttcgaa
ggcttgacgcagcccaacggctacaccgaaccgttgctgcacaagtaccgtctgcaattc
aaggctgccgcgcaggcctga

DBGET integrated database retrieval system