KEGG   Achromobacter sp. AONIH1: C2U31_06400Help
Entry
C2U31_06400       CDS       T05288                                 

Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00230  Purine metabolism
achr00240  Pyrimidine metabolism
achr00760  Nicotinate and nicotinamide metabolism
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C2U31_06400
   00240 Pyrimidine metabolism
    C2U31_06400
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C2U31_06400
Enzymes [BR:achr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     C2U31_06400
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     C2U31_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos PGA_cap
Motif
Other DBs
NCBI-ProteinID: AUT49996
UniProt: A0A2I8DRI5
Position
complement(1384932..1386827)
Genome map
AA seq 631 aa AA seqDB search
MLGMMALVAACGGSDDDDDSPAPTPPTTPPVAARPMELTILHINDHHSNLDSKKKDFKLK
NAAGATVTVNADAGGFARVTGAIKALSAASPNVLKLHAGDATTGTLYFNRAGDPGEADAA
MMNTVCFDAMTLGNHEFDKGDSGLKRFIDLLHKGACQTPVLSANVTFGANSALNPSRAPG
LVKPSIVLQRDGQSIGLVGLTIANKTQQSSSPDPGTVFGDETAAAQQQIDALRAQGVNKI
IVMSHIGYDYDKQIIPNLSGVDVVVGGDSHTLLGPAGMAGYGVGSPAGAYPTEVKNKDGK
RVCLVQAWEYSQVVGELKVSFDANGDVTACAGTPHVLMGSAYKIGGAAVSPADQAAIAAD
IKASGFLYPQEPDAGALAVLQPFKAKVDTFSASQVAKVPQELCSRRVPGGPGSRDYSRSG
VDCNTLGSVSLRGGDIQQLVAQAYLEVGNASYGGADISLQSGGGVRVPLKGTVTAANVIE
VVPFGNMLWRLNVTGAEVKSMLEDGMQAVYGPGGSTGPYPYTGGLRFDVNAAQPQGSRVS
NIEVYDAATSSWGPLDASRTYKLFVLSFNATGGDGYKTLANVPAARRQDIGVLDADVLQA
YIDKQAKDPATGLPVLNLLPISQYSTKSYTE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaatgatggcgctggtggccgcctgcggcggcagcgacgatgacgacgacagc
ccggcgccgaccccgcccaccacgccgcccgtggccgcccggccgatggagctgacgatc
ctgcacatcaacgatcatcactccaatctggacagcaagaagaaggacttcaagctcaag
aacgccgccggcgcgaccgtgacggtcaacgccgacgccggtggcttcgcccgcgtgacg
ggcgccatcaaggcgctctcggccgcctcgcccaatgtgctcaagctgcacgccggtgac
gccaccaccggcaccctgtacttcaaccgcgccggcgatccgggcgaagccgacgcggcc
atgatgaacacggtctgcttcgacgccatgacgttgggcaaccacgagttcgacaagggc
gacagcggcctgaagcgcttcatcgacctgctgcacaagggcgcctgccagacgccggtg
ctcagcgccaacgtgaccttcggcgccaattccgcgctgaacccctcgcgcgcgcccggc
ctggtcaagccctccatcgtgctgcaacgcgacggccagtccatcggcctggtcggcctg
accatcgccaacaagacgcagcagtcgtccagccccgatcccggcaccgtgttcggcgac
gagaccgccgccgcgcagcagcagatcgacgcgttgcgcgcgcaaggcgtgaacaagatc
atcgtgatgagccacatcggctacgactacgacaagcagatcatccccaacctgagcggc
gtggacgtggtggtgggcggcgattcgcacaccctgctcgggccggctggcatggcgggc
tacggcgtcggctcgccggccggcgcctaccccaccgaagtcaagaacaaggatggcaag
cgcgtctgcctggtgcaggcctgggaatactcgcaggtggtgggcgagctgaaggtcagc
ttcgacgccaatggcgacgtgacggcctgcgccggcacgccgcacgtgctgatgggcagc
gcctacaagatcggcggcgcggcggtctccccggcggaccaggccgccatcgcggccgac
atcaaggccagcggcttcctgtatccgcaggagccggacgccggcgcgctggccgtactg
cagcccttcaaggccaaggtcgacacgttcagcgccagccaggtggcgaaggtgccgcag
gaactgtgctcgcgccgcgtgccgggcgggcccggctcgcgcgactacagccggtccggc
gtggattgcaacacgctgggcagcgtcagcctgcgcggcggcgacatccagcagctggta
gcccaggcctacctggaagtgggcaacgccagctacggcggcgccgacatctcgctgcaa
agcggcggcggcgtgcgcgtgccgctcaagggcaccgtcacggcggccaatgtgatcgag
gtggtgcccttcggcaacatgctgtggcgcctgaacgtgaccggcgccgaggtcaagagc
atgctggaagacggcatgcaggcggtctacggcccgggcggatcgaccggtccatacccg
tacacgggcggcctgcgcttcgacgtcaacgccgcgcagccgcaaggcagccgggtatcc
aacatcgaggtctacgacgccgccacgtcctcatggggtccgctggacgccagccgcacg
tacaagctcttcgtgctgagcttcaacgccaccggcggcgacggctacaagaccctggcc
aatgtgccggccgcgcgccggcaggacatcggcgtgctggatgccgacgtgctgcaggcc
tacattgacaagcaggccaaggatccggccaccggcctgccggtgctgaatctgctgccg
atcagccagtacagcaccaagtcctataccgagtag

DBGET integrated database retrieval system