KEGG   Achromobacter sp. AONIH1: C2U31_07940Help
Entry
C2U31_07940       CDS       T05288                                 

Definition
(GenBank) acyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00473  D-Alanine metabolism
achr01100  Metabolic pathways
achr01503  Cationic antimicrobial peptide (CAMP) resistance
achr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C2U31_07940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C2U31_07940
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    C2U31_07940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:achr01504]
    C2U31_07940
Enzymes [BR:achr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     C2U31_07940
Antimicrobial resistance genes [BR:achr01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    C2U31_07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AUT45920
UniProt: A0A2I8DF73
Position
1723387..1723626
Genome map
AA seq 79 aa AA seqDB search
MHTEQELHTKIGEIVESIVLKKVTPDTQLIATGLVDSLAAVDITLAVESEYGCSIPAPEI
AEHLQSVRTLAGYVAAHTS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgagcaagaactccacaccaagatcggcgagatcgtcgagtcgatcgtcctc
aagaaagtcactcccgacacgcagttgatcgctaccggcctggtggattcgctcgccgcc
gtggacatcacgctggctgtcgagtccgagtacggctgcagcataccggctccggagatc
gcggagcatttacagtcggttcgcacgcttgccggctatgtcgctgcccatacttcgtaa

DBGET integrated database retrieval system