KEGG   Achromobacter sp. AONIH1: C2U31_14880Help
Entry
C2U31_14880       CDS       T05288                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00020  Citrate cycle (TCA cycle)
achr00640  Propanoate metabolism
achr00660  C5-Branched dibasic acid metabolism
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
achr01120  Microbial metabolism in diverse environments
achr01130  Biosynthesis of antibiotics
achr01200  Carbon metabolism
Module
achr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
achr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U31_14880
   00640 Propanoate metabolism
    C2U31_14880
   00660 C5-Branched dibasic acid metabolism
    C2U31_14880
Enzymes [BR:achr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     C2U31_14880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AUT47162
UniProt: A0A2I8DJ41
Position
3249541..3250422
Genome map
AA seq 293 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTRMCREYANGKAAFVAGVNPKKAGEDFEGVPIFASV
KDAKADTGATVSVIYVPPAGAAAAIWEAVEAELDLVICITEGIPVRDMLEVKNRMKAKGS
KTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGIVSRSGTLTYEAVAQVTELGLGQSSA
VGIGGDPINGLKHVDVLKMFNDDPDTDAVIMIGEIGGPDEVNAAQWAKDNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTADAKLEVMEACGIRTTRNPSEMGKLLKSVL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctgatcaacaaggacaccaaggtcatcacccagggcatcacgggcaagacg
ggccagttccacacccgcatgtgccgtgagtacgccaatggcaaggccgccttcgtggct
ggcgtgaacccgaagaaggcgggcgaggacttcgaaggcgtgccgatcttcgcgtcggtc
aaggacgccaaggccgacaccggcgccaccgtgtccgtcatctacgtgccgcccgcgggc
gccgccgccgccatctgggaagccgtcgaggccgaactggatctggtgatctgcatcacc
gaaggcatcccggtccgtgacatgctggaagtcaagaaccgcatgaaggccaagggcagc
aagaccctgctgctgggcccgaactgccccggcctgatcaccccggacgaaatcaagatc
ggcatcatgccgggccacatccaccgcaagggccgcatcggcatcgtcagccgctcgggc
accctgacgtacgaagccgtggcgcaagtcaccgaactgggcctgggccaatccagcgcc
gtgggcatcggtggcgatcccatcaacggcctgaagcacgtcgacgtgctgaagatgttc
aatgacgatcccgacaccgacgccgtcatcatgatcggcgaaatcggcggcccggacgaa
gtgaacgccgcccagtgggccaaggacaacatgaagaagccggtcgtcggcttcatcgcc
ggtgtcaccgctcctcccggaaagcgcatgggccacgccggcgcgctgatctcgggcggc
gccgacaccgccgacgccaagctggaagtcatggaagcctgcggcatccgcaccacgcgc
aacccctccgaaatgggcaagctgctcaagtcggtgctgtaa

DBGET integrated database retrieval system