KEGG   Achromobacter sp. AONIH1: C2U31_17745Help
Entry
C2U31_17745       CDS       T05288                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00562  Inositol phosphate metabolism
achr00564  Glycerophospholipid metabolism
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
achr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    C2U31_17745
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2U31_17745
   00565 Ether lipid metabolism
    C2U31_17745
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C2U31_17745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:achr02042]
    C2U31_17745
Enzymes [BR:achr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     C2U31_17745
Bacterial toxins [BR:achr02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   C2U31_17745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 GDPD_2
Motif
Other DBs
NCBI-ProteinID: AUT47672
UniProt: A0A2I8DKJ5
Position
3861241..3863448
Genome map
AA seq 735 aa AA seqDB search
MKSDKDLVHAGKRRFLRNAAASTAGLTAMSMFPPAIRRALAIPANNRTGTINDVEHVVIL
MQENRSFDMYFGTYKGVRGFGDRITIPLPQNRSVWEQHNGTRVVMPYHLDSKQGNAQRVS
GTPHDYMDAQQAWDGGRMYQWPRYKQNQSMGYYEQQEVEFQYALAEAFTLCDAYHCSTHG
GTNTNRLFHWTGTNDPLAMSNGPSTRNQWDSMGASSTGWSWKTYPERLQENGVTWKVYQN
LPDNFTDNPLAGFKQFRRANELAGNNPNAPWSPSVDAANPLYKGVANTMPDGGFLKALRD
DALNGTLPQVSWIVAPANYSEHPGPSSPVQGAWYIQETLDALTANPDVWSKTVLLINFDE
NDGYFDHVPPPAAPSLDTADGTLPAGAVSGALAGASTVNTDLDRHTRPSQQDPADHRVYG
PGPRVPMYVVSPWSRGGWVNSQSFDHTSVLRFLEARFKIKEENISPWRRAVLGDLTSAFN
FVTPNNETLPDLKLLTRAGADQLRTDQQALPQVTVPDPSVQAKPQQRTGVRYSRALPYEQ
HVSCRAQAGASAVGLVFANTADFPKMSVPASVFHVYDKLHLDRIPRRYTVEPGKQLEGRW
DAAADGGKYDLWVMGHNGFLRHFAGDLALARTAQLDAEIRVCYDIANGDVYAKFMNNGVA
PCTFVVTPNAYYVNHERWTLTVPAGGQVEQAWPLANSNAWYDFSVTLNEDPAYLRRFAGR
VETGRHGSSDPAMGT
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtccgataaagacctggtccatgccggcaagcgccgcttcctgcgcaacgccgcc
gcctcgaccgcgggcctgaccgccatgtcgatgttcccgccggccatccggcgcgcgctg
gcgattccggcgaacaaccgcaccggcaccatcaacgacgtcgagcacgtggtcatcctg
atgcaggagaaccgctcgttcgacatgtactttggcacctacaagggcgtgcgcggcttc
ggcgaccgcatcaccatcccgctgccgcagaaccgcagcgtctgggaacagcacaatggc
acccgcgtggtcatgccgtaccacctggacagcaagcagggcaatgcccagcgcgtgtcc
ggcacgccgcacgactacatggacgcgcagcaggcctgggacggcggccgcatgtaccaa
tggccgcgctacaagcagaaccagtcgatgggctactacgagcagcaggaggtggagttc
cagtacgcgctggccgaagccttcacgctgtgcgatgcctatcactgttccacgcatggt
ggcaccaataccaaccgcctgttccactggaccggcaccaatgacccgctggcgatgagc
aacggcccgtcgacccgcaaccagtgggacagcatgggcgcgtccagcaccggctggagc
tggaagacctatcccgagcgcctgcaggaaaacggcgtgacctggaaggtctaccagaac
ctgccggacaacttcaccgacaacccgctggccggcttcaagcagttccgccgcgccaac
gagctggcgggcaacaatcccaacgccccgtggtcgccgtcggtggacgcggccaatccg
ctgtacaagggcgtggccaacaccatgccggacggcggcttcctgaaggcgctgcgcgac
gatgcgctcaacggcacgctgccgcaggtgtcctggatcgtggcgccggccaactactcc
gagcaccccggcccgtcgagcccggtgcagggcgcctggtacatccaggagacgctggac
gcgctgaccgcgaatccggacgtctggagcaagacggtgctgttgatcaacttcgacgag
aacgacggctatttcgaccatgtgccgccgcccgccgcgccctcgctcgataccgccgac
ggcacgctgcccgccggcgccgtcagcggcgcgctggccggcgcgtcgacggtcaatacc
gatctggatcgtcacacccggccctcgcagcaggacccggccgatcaccgcgtctatggc
ccgggcccacgcgtgccgatgtatgtggtctcgccctggagccgcggcggctgggtcaac
tcgcagtccttcgaccacacctcggtgctgcgcttcctggaggcgcgcttcaagatcaag
gaagagaacatcagcccgtggcgccgcgcggtgctgggcgacctgacctcggccttcaac
ttcgtcacgcccaacaatgaaacgctgccggacctgaagctgctgacgcgcgccggcgcc
gatcagttgcgcacggaccagcaggccctgccgcaggtcacggtgcccgatcccagcgtg
caggccaagccgcagcagcgcaccggcgtgcgctactcgcgcgccttgccctacgagcag
cacgtcagctgccgcgcgcaagcgggtgcttccgccgtgggcctggtgttcgccaacacg
gcggactttcccaagatgtcggtgccggcctcggtgttccatgtctatgacaagctgcat
ctggaccgcatcccgcgccgctatacggtggaacccggcaagcagctcgagggccgctgg
gatgccgccgccgacggcggcaagtacgatctgtgggtgatgggccacaacggtttcctg
cggcatttcgctggcgacctggcgctggcgcgcacggcgcagctggatgccgaaatccgc
gtctgctacgacatcgccaacggcgatgtctacgccaagttcatgaacaatggcgtcgcg
ccgtgcaccttcgtggtcacgcccaacgcctactacgtgaaccacgagcgctggacgctg
accgtgccggcgggcgggcaggtggaacaggcctggccgctggccaacagcaacgcctgg
tacgacttcagcgtcacgctgaacgaagatccggcctatctgcgccgcttcgccggccgt
gtggaaaccggcaggcacggctcgtccgatcccgcgatgggcacctga

DBGET integrated database retrieval system