KEGG   Achromobacter sp. AONIH1: C2U31_23555Help
Entry
C2U31_23555       CDS       T05288                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
achr  Achromobacter sp. AONIH1
Brite
KEGG Orthology (KO) [BR:achr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U31_23555
Enzymes [BR:achr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     C2U31_23555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AUT48709
UniProt: A0A2I8DNE1
Position
complement(5141703..5142548)
Genome map
AA seq 281 aa AA seqDB search
MTSPILNIDLHCHSTVSDGALAPREVAARAHANGVDVWALTDHDEIGGLAEAAGAARELG
MRFATGVEISVTWAGLTVHVVGLRFDPSNVALAEGLRKTRAGRAERAKRIGERLAGMGMP
GAYEGALPFAGNPELISRTHFARYLVEAGYCPDVQTVFNKYLGDDCAGHVPMQWATLAEA
VGWIRGAGGRAVIAHPGRYKYTPLQFAALFDEFIELGGEGIEVNTGSHTADEARKYADVA
RRYGFLASRGSDFHSPTESRMDLGRLPALPPDLKPVWHDWF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccattctgaacatcgacctgcattgccattccaccgtttcggacggcgcg
ctcgcgccgcgcgaggtggcggcgcgggcgcatgccaacggcgtggatgtctgggccctg
accgaccacgacgagatcggcggactggccgaggccgccggggccgcccgggaactgggc
atgcgcttcgccaccggggtcgagatctctgtcacctgggccggcctgacggtgcatgtc
gtgggcctgcggttcgacccgtccaacgtggcgctggccgagggtctgcgcaagacccgc
gccggccgcgccgagcgcgccaagcgcatcggcgagcggctggccggcatgggcatgccc
ggcgcctacgagggcgcgctgcccttcgccggcaatcccgagctgatcagccgcacccac
ttcgcccgctacctggtcgaggccggctattgcccggatgtgcagaccgtcttcaacaag
tatctgggtgacgattgcgccggccacgtgccgatgcaatgggccacgctggccgaggcc
gtgggctggatacgcggcgccggcgggcgcgccgtcatcgcgcacccgggccgctacaag
tacacgccgctgcaattcgccgcgctgttcgatgagttcatcgagctgggcggcgagggc
atcgaagtgaacaccggcagccatacggccgacgaggcccgcaagtacgccgacgtggcg
cgtcgctacggcttcctggcctcgcgcggctcggacttccacagccccacggaaagccgg
atggatctcgggcgcctgcccgcgctgccgccggacctgaagccagtctggcacgactgg
ttctag

DBGET integrated database retrieval system