KEGG   Achromobacter sp. AONIH1: C2U31_28525Help
Entry
C2U31_28525       CDS       T05288                                 

Gene name
cobA
Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
achr  Achromobacter sp. AONIH1
Pathway
achr00860  Porphyrin and chlorophyll metabolism
achr01100  Metabolic pathways
achr01110  Biosynthesis of secondary metabolites
achr01120  Microbial metabolism in diverse environments
Module
achr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:achr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C2U31_28525 (cobA)
Enzymes [BR:achr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     C2U31_28525 (cobA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     C2U31_28525 (cobA)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     C2U31_28525 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Aldolase
Motif
Other DBs
NCBI-ProteinID: AUT49577
UniProt: A0A2I8DQB0
Position
6257819..6259249
Genome map
AA seq 476 aa AA seqDB search
MKLFPLFADLNGRPALVVGGGAVAERKTLALLEAGAAVTVGAPGLTPALAALAADGRIRH
HPGRFDPAWLDAVWLVVAATDDTGVNREVSEAAEARRLFCNVVDDPALSSFQVPSIVDRS
PVIVAISSSGVAPVLARRLRERIESLFDHTLGQLAGLADRYRQRIRAGHPDLGARRRFYD
WLLDGPVAGLLRQQRPDQAEAALATALDQPLRPAEGSVVLVGAGPGDPGLLTLKALRALN
EADVIMYDRLVSDDIMALARRDATRVSVGKQPGEDHHATQARIHALLVEHARAGRRVVRL
KGGDAFIFGRGGEELEYLREHGVRYEVVPGITAALACAAYAGIPLTHREHAQSVRLVTAH
CRDDEDNLDWPALAREKQTLAFYMGVGQLDALSRRLISHGRAPDTPFALIENGSRPEQRV
LSGAVKDLPDLARAHGIRSPALLIVGEVAGLASRLQWFGRHIDGGQGDGQPQRLAA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttccccctgttcgccgatctgaacggccgccccgcgctggtcgtgggcggc
ggcgccgttgccgaacgcaagacgctggcgctgctcgaagcgggcgccgccgtgaccgtg
ggcgcgcccgggctgacgcccgccctggccgcgctggccgccgatggccgcatccgtcac
catccgggccggttcgaccccgcctggctggacgccgtctggctggtcgtggccgccacc
gacgacaccggggtcaaccgcgaggtctccgaagccgccgaggcccgccgcctgttctgc
aatgtagtggacgatccggcgctgtcctcgttccaggtgccgtccatcgtggaccgctcg
ccggtgatcgtggcgatctcgtcctcgggcgtggccccggtgctggcccgccgcctgcgc
gaacgcatcgaatcgctgttcgaccacaccctgggccagctggccggactggccgatcgc
taccgccagcgcatccgcgccggccatcccgacctgggcgcccggcgccgcttctacgac
tggctgctggacggccccgtggccgggctgctgcgccagcagcggccggaccaggccgag
gccgcgctggccaccgccctggaccagcccctgcgccccgccgagggcagcgtggtgctg
gtgggcgccggaccgggagaccccggcctcttgacgctcaaggcgctgcgggcgctgaac
gaggccgacgtgatcatgtacgaccgcctggtcagcgatgacatcatggccctggcgcgg
cgcgacgcgacgcgcgtgtcggtgggcaagcagcccggcgaagaccatcacgccacccag
gcccgcatccacgcgctgctggtcgagcacgcgcgcgccggacgccgcgtggtgcggctc
aagggcggcgacgccttcatcttcggacgcggcggcgaggaactcgaatacctgcgtgag
cacggcgtgcgctatgaggtggtgcccggcatcacggccgcgctggcctgcgccgcctac
gccggcattccgctgacgcaccgcgagcacgcgcaatcggtgcggctggtgacggcccac
tgccgcgacgacgaagacaacctggattggcccgcgctggcccgcgagaagcagacgctg
gcgttctacatgggcgtgggccagctggacgcgctcagccgccggctgatttcgcacggc
cgcgcgccggacacgccgttcgcgctgatcgagaacggcagccgcccggaacagcgcgtg
ctgtcgggcgcagtgaaggacctgcccgatctggcgcgggcgcacggcatccgctcgccc
gccctgctcatcgtgggcgaggtggcgggactggcgtcccgcctgcaatggttcggccgc
catatcgatggcggccagggcgacggccagccgcagcgcctggccgcctga

DBGET integrated database retrieval system