KEGG   Acinetobacter baylyi: ACIAD0169
Entry
ACIAD0169         CDS       T00185                                 

Definition
(GenBank) hypothetical protein; putative signal peptide
Organism
aci  Acinetobacter baylyi
SSDB
Motif
Pfam: DUF4407 Dicty_spore_N
Other DBs
NCBI-ProteinID: CAG67142
UniProt: Q6FFL5
Position
172382..173107
AA seq 241 aa
MFSRYVVGTGLVLLVFGSTISACADSSSVDCNKNNVYESIQCIEKENKKLIIKLDNEKNR
EKNDYNKWVKKIKNNCEGKISHIAGEGAGLVRNQCYRDEYLSRLSFLTTGKTSKEENIHG
LVVTHLPYNSVDHFKCLLKKDINSCSKVNLVSSSNLIKFYPSISPNYGDGIVLPETESGK
QIIISPFEDNEDEGPQLAILIINAFGVEEKKFIPATKNVLIDKNYNLTYMEGNKEKRIQL
K
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtttagtagatatgtggttggtacaggattagtattattagtatttggttcaacaata
tcagcatgtgcggatagttcatcagtagattgtaataaaaataatgtttatgaaagtata
caatgtatagaaaaggaaaataaaaaattaattattaaacttgataatgaaaaaaataga
gaaaaaaatgattataataaatgggtgaagaaaataaaaaataattgtgaaggaaaaata
agtcatatagctggggaaggtgcaggtctagttagaaatcaatgttatagagatgagtat
ttatctagattatcatttttaacaactggaaaaacttcgaaagaagaaaatattcatggt
ttagtggtaacacatttaccttacaattcagttgatcattttaaatgtcttttaaagaaa
gatataaatagttgttctaaagttaatttggtgagctcatctaatttgataaaattctat
ccatctatttctccaaattatggggatggtattgttcttccagaaacagaaagtggtaaa
caaatcattatttctccatttgaagataatgaggatgagggtccacaacttgcgatttta
atcattaatgcttttggtgtagaagaaaagaaatttatcccagcaactaaaaatgtatta
atcgataagaattataatttaacttatatggaaggtaataaagaaaagcgaatacagttg
aaataa

DBGET integrated database retrieval system