KEGG   Acinetobacter sp. ADP1: ACIAD0191Help
Entry
ACIAD0191         CDS       T00185                                 

Definition
(GenBank) conserved hypothetical protein; putative enzyme related to aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00010  Glycolysis / Gluconeogenesis
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD0191
Enzymes [BR:aci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ACIAD0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAG67161
UniProt: Q6FFJ6
Position
186781..187665
Genome map
AA seq 294 aa AA seqDB search
MINFAEVSGITIENLGEHGLKALRISNTFCDALIALQGAQILEFNVKYQSYTQALLWLSE
LNSYQPAKAIRGGIPLCFPWFGGHAEEKSYPSHGFARNLEWALVDVVDIQESGHQLIFEL
TDNALTRAYWDVAFRLQMQIECGTQLRLSLSLVNLDEKQIHYGFAWHSYFPVKIDEAAVY
GLQGKAFIDQLDQHRHKIQHEEAIHFSEEIDRIYPLTQGSFQLRANHRTTLLINSHAQSA
VIWNPWIEKTARLADLKPESWREFVCVESGQIASQQQYLEAGQSVEYTLEISAV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattttgcagaagtatcaggtattacaattgaaaatttaggggaacacggttta
aaggcactacgaatttcgaatacattttgtgatgccttgatcgctttacaaggtgcacaa
attctagagtttaatgtcaagtatcagtcttatacacaagcattactctggctttccgaa
ctcaattcatatcagcccgcaaaagccatacgcggtggcataccgttgtgttttccttgg
tttggtggacatgcagaagaaaaatcatacccttcacatggttttgctagaaatctggag
tgggcactggtcgatgtggttgatatacaagaatcaggtcatcaacttatatttgaattg
acagacaatgctctcaccagagcatattgggatgtcgcttttcgtttacagatgcaaatc
gaatgtggtacacagcttaggctgagtttgtctttagtcaatctcgatgaaaaacagatt
cactatggatttgcctggcacagttattttcctgtcaaaattgatgaggcagcagtgtat
ggtttgcaaggcaaagcgtttatcgatcaactggatcaacatcggcacaagatacaacat
gaagaagccattcatttctctgaagaaatcgaccggatttatccattgacccaaggttcc
ttccagttaagagcaaaccataggacgacgctattgatcaacagtcatgctcagagtgct
gtgatctggaatccttggattgagaaaaccgcacgtttagctgacttaaaacctgaaagc
tggcgagaatttgtatgtgttgaatctgggcagattgcttcacagcagcagtatctcgaa
gcgggtcagtcggttgaatatactttggaaatctcagcagtttaa

DBGET integrated database retrieval system