KEGG   Acinetobacter sp. ADP1: ACIAD0753Help
Entry
ACIAD0753         CDS       T00185                                 

Definition
(GenBank) putative D-cysteine desulfhydrase (DcyD)
  KO
K05396  D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ACIAD0753
Enzymes [BR:aci01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     ACIAD0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAG67658
UniProt: Q6FE50
Position
complement(738578..739462)
Genome map
AA seq 294 aa AA seqDB search
MFDSIAQDIPYHTLIDGSPVRLDLKRLDLIHPHISGNKFYKLKYNLIEAKKRGCDRILTF
GGAFSNHIAASAYAAHHFDFKSIGIIRGQELAYRSLNATLKTAQHYGMQLEFMSREQYRQ
KDQSEFLHTLQSQYPSAFIIPEGGTNALAIQGSKEILSDTDRLNYDVICCAVGTGGTLAG
LIEASHHGQYVIGFSALKGDFLHNDVQRHTNKTNWHILDDYCFGGYAKTSSELFDFIAGF
EQKYQIPLEQVYTAKMLYGLLDLIQKNDFDQGTRILALHTGGLQGRRHDIGVTE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactctatcgcccaagatattccatatcacacattaatcgatggctcacctgtt
cgtcttgatctcaagcgacttgatcttatccatccacacatttcaggcaacaagttttat
aaacttaaatacaatcttattgaagcaaaaaagcgcggttgtgatcgtattttgactttt
ggaggtgccttttccaatcatatcgcagccagtgcctatgccgcacatcattttgatttt
aaaagtatcggtattattcgtggtcaagagctggcgtatcgttctctcaatgcaacatta
aaaactgcacagcactatggcatgcaacttgagtttatgtcacgtgagcaatatcgccaa
aaagatcagtcagaatttttacatacgcttcaaagtcaatacccatctgcctttatcatt
ccagaaggtggaacgaatgcacttgccatacaaggcagcaaagaaatcttgagtgataca
gatcgactcaattatgatgtcatctgctgtgcggttggtactggtggtacactggctgga
ctgattgaagccagccatcatgggcaatatgttataggtttctccgcactcaaaggagac
tttcttcacaatgatgtccagcgccataccaataaaaccaactggcatattctggatgat
tattgctttgggggatacgcaaaaacatcttctgaactgttcgactttatagctgggttt
gaacaaaaatatcagattccactcgaacaggtatataccgccaaaatgctatatggactg
ctcgacctgattcagaaaaatgattttgatcaaggtacacgcatccttgctctgcataca
ggcggtttacaaggacgtcgccatgacattggcgttacagaataa

DBGET integrated database retrieval system