KEGG   Acinetobacter sp. ADP1: ACIAD0902Help
Entry
ACIAD0902         CDS       T00185                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00010  Glycolysis / Gluconeogenesis
aci00030  Pentose phosphate pathway
aci00051  Fructose and mannose metabolism
aci00052  Galactose metabolism
aci00230  Purine metabolism
aci00500  Starch and sucrose metabolism
aci00520  Amino sugar and nucleotide sugar metabolism
aci00521  Streptomycin biosynthesis
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACIAD0902 (algC)
   00030 Pentose phosphate pathway
    ACIAD0902 (algC)
   00051 Fructose and mannose metabolism
    ACIAD0902 (algC)
   00052 Galactose metabolism
    ACIAD0902 (algC)
   00500 Starch and sucrose metabolism
    ACIAD0902 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    ACIAD0902 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    ACIAD0902 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACIAD0902 (algC)
Enzymes [BR:aci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ACIAD0902 (algC)
    5.4.2.8  phosphomannomutase
     ACIAD0902 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAG67799
UniProt: Q6FDQ9
Position
885462..886886
Genome map
AA seq 474 aa AA seqDB search
MDIKQAFPFQIFRAYDIRGKLNILTPERIVAIAHGLASQYLDAEQTCVVIGYDARLTSPS
YAQLIQSVFEQRGLTVINMGCCSTPLMYFTARHYEGNGVMITASHNPKSDNGIKWLIDNE
PPSPEMIQQVGWSASQIRVDASDFQSCTAIPHQIKTEFFNVYQDTILQDIHLNRSFKVVL
DGLHGSAGQCAKILLEKLGCDVIALRCEANGEFPDHAPDPSQAKHLESLRQQIILQRADI
GIALDGDGDRLVVIDEHTNIISADRLISLFSHLCLQTLPAREIVFDVKCSTMVRNTVLNC
SGTPKMIRTGSSFLRKYLAQSQGHAIFGGEYAGHYVFNDGRGFGFDDGIYAALRLLEYLS
QSPQQTIFQLLQAYPERCSTEDLYISTHHANPEVVLKYIEQFAQHIPAQLSKIDGIRLDF
EDGFGIIRASNTGEYFTVRFDADTPQRLAEIRQIFIVMLQKQYPNIAHDLSQAY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaagcaggcttttccgtttcagatttttcgtgcatacgatattcgtggaaaa
ctgaatatattgacacctgaacggatcgttgcaattgctcatggattggcatctcaatat
ttggatgcagagcaaacatgtgtcgttattggatatgatgcccgtttaaccagtccctct
tatgcacagttaattcagtctgtatttgagcaacgtggtctaacggtgatcaacatgggg
tgttgttctacgcccctaatgtacttcacggcacgccactacgaaggaaatggagtgatg
atcacggccagccataacccaaaatcagacaatggcattaagtggctcattgataacgaa
ccaccatcaccagagatgattcagcaagtagggtggtcagcttcccagattcgggtggat
gcgtcagattttcaatcttgtactgcaataccacatcaaatcaaaaccgagttttttaat
gtttatcaagatacgatccttcaagatattcatttaaaccgatcctttaaagtggtattg
gatggtttacatggttccgcaggtcaatgtgcaaaaattttactcgaaaaactcggatgt
gacgtgattgcactgcgctgcgaggcaaatggtgaatttccagatcatgcacctgatcct
tctcaggcaaagcatcttgagtctttgcgccagcagatcatattgcagcgggctgacatc
ggaattgcacttgatggagacggagaccgtttggtggtgattgatgaacacaccaacatc
attagtgcagatcggctcatttcattgtttagtcatttatgcttgcaaacattacccgca
cgtgaaattgtatttgacgtaaaatgttcaacgatggtccgaaataccgtattgaactgt
tctggcacacctaagatgattcgtactggcagcagctttttacgcaagtatctggctcaa
tcacaaggacatgcgatttttggtggcgaatatgcaggtcattatgtgtttaatgacggg
cgtggttttggttttgatgatggcatttatgcagctttgcgcttgctcgaatatttaagc
caatctccacagcaaaccatttttcaattattacaagcctatcctgagcgttgttctact
gaagatctgtatattagtacgcatcatgcgaacccagaagtcgttttaaaatatatagag
cagtttgcacaacatatacctgcacagttaagtaaaattgatggtatccgtcttgatttt
gaagacggttttggcattattcgagcatccaacacgggtgaatattttactgtgcgtttt
gatgcggatacgccccagcgtttagctgaaatcagacaaatatttatcgtcatgctgcaa
aagcaataccctaacattgcacatgatctttcacaggcttattaa

DBGET integrated database retrieval system