KEGG   Acinetobacter baylyi: ACIAD0982
Entry
ACIAD0982         CDS       T00185                                 

Symbol
vanK
Name
(GenBank) vanillate transporter (MFS superfamily)
Organism
aci  Acinetobacter baylyi
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-ProteinID: CAG67874
UniProt: O24842
Position
968383..969729
AA seq 448 aa
MQRDILSEINQNNMSRYQWFVIVVCVCLNIIDGFDVMVMAFTAPSVSAEWSLSGAQIGLL
LSAGLFGMAAGSIFLAPLADKIGRRLLILICLAIAGISMLACGLVHSHSMLAALRFVTGI
GVGGILASSNVLASEYANLRWRSLAVSLMSTGYGIGATLGGILSLLLIEHLGWRSIFLAG
GVTTVVMLLVSLWLLPESLDYLLAKKPKQALEKINLTVQRIGLVRLNALPQHEKNTQQHS
SDIAKLFQGKQGFQTLCLWFAFFLVMFGFYFVMSWTPKILIAMGMSPSQGVTTGILISIG
GVFGAAIIGLLASRIKIFHALSLFLGLTAVCVWLFVAVSSQVSIALMVGLLLGTLINGCV
AGLYSISPTIYDADIRSRGVGYAIGFGRIGAILSPTVAGIFLDKGLAPSTLYAYYGIVFI
LAIFLILSLSKAFYRQKEGLGSSIKTVA
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcaaagagacattttaagcgaaattaatcagaataatatgagccgttatcaatggttt
gtgatcgttgtttgcgtgtgtctcaatattattgatggctttgatgtgatggtcatggca
tttacagctccatctgtttcagctgagtggtcactttcaggtgcacaaatcgggcttcta
cttagtgctggtttgtttggcatggctgcgggttctatttttctggcacctctggcagac
aaaattggtcgccgtttactgattttaatttgtttagctattgcaggcatcagcatgctc
gcctgtggtttggtgcatagccacagtatgttggcagcattacgctttgtgacaggtatt
ggggtggggggtattttagccagtagcaacgttttggccagtgaatatgccaatttacgc
tggcgtagtcttgctgttagtctcatgtcaacggggtatgggattggcgcaacattaggc
ggcatattgtcattactattgattgagcatttaggctggcgttcgatctttctggcgggt
ggtgtgacgacagttgtaatgttattggtgagcttatggttattaccagaatcactggat
tatttattggcgaagaaaccgaagcaagcactagaaaaaatcaatctgaccgtgcagcgt
atcggacttgttcgcttaaatgccttaccacagcatgaaaaaaatacacaacagcacagc
agtgatattgccaagctttttcaaggcaagcagggatttcaaacattatgtttgtggttt
gctttctttctggtcatgttcggtttttattttgtgatgagctggacaccaaaaattctg
attgcaatgggcatgtcgccaagtcagggcgtaacgacaggaatcttaattagtattggt
ggtgtttttggtgctgcaattattggtcttttggcatcacgtattaaaatctttcatgcc
ttaagtctctttttgggattaaccgctgtgtgtgtatggttgttcgtggccgtatcttcg
caagtgagtattgcactcatggtcggtttattgcttggtacactcattaatggctgtgtg
gcgggtttatattctatttctcccactatttatgacgcagatatacgtagtcgtggtgta
ggttatgccattggttttggccgtattggtgcaattttatcaccaacagtggcaggtatt
tttctcgataaaggcttagctccgtcaaccttgtatgcctattacggtattgtttttatt
ttagcgattttcctgattctgagcttgagtaaggcattttatcgccagaaagaaggtcta
ggaagttctataaaaacagttgcttaa

DBGET integrated database retrieval system