KEGG   Acinetobacter baylyi: ACIAD1007Help
Entry
ACIAD1007         CDS       T00185                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase, FAD/NAD(P)-binding domain
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
aci  Acinetobacter baylyi
Pathway
aci00020  Citrate cycle (TCA cycle)
aci00620  Pyruvate metabolism
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01200  Carbon metabolism
Module
aci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACIAD1007 (mqo)
   00620 Pyruvate metabolism
    ACIAD1007 (mqo)
Enzymes [BR:aci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ACIAD1007 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase FixQ
Motif
Other DBs
NCBI-ProteinID: CAG67898
UniProt: Q6FDG0
Position
complement(994715..996346)
Genome map
AA seq 543 aa AA seqDB search
MKKFLKYLAVFLVVLLIAAIAFLFRPIASKKIQTSANEPVVDVVLVGGGIMSATLGTYLT
ELEPNWQIRMYERLDRVAQESSNGFNNAGTGHSGFMEMNYTEEKDGKMDISKAVKVAEQF
EISKQFWAYQVKHNVLGQPSSFINPVPHHAFVWGDNVAFLEKRYAAMIKNPLFYGMQFTE
NANQIKQWAPLTMEGRDPAQKVAATRMEIGSDVNYGAITTQLVNNLDKHQNFKLSTSSEV
TGISQNDDKTWTVAFKNLKTGKADHVKTRFVFIGAGGASVKLLQMTGLPESKQYAGFPVG
GVFLMTDNPKIAAEHTAKLYGRAELGAPPMSVPHIDTRYIDGKKYVLFGPFATYSNKFLK
QGSQFDLLASTNKNNVLPMTAVGMENLDLVKYLVSQVMMTDEDRFNELKKYYPNAKREDW
RLNQGGQRVQVIKKEEGKPAKLQFGTEVFVSKDRSVTALMGASPGASTSPYIMLNLLEKA
FPQQVKGEWNPKLHEIVRSYKQDLSDNPVLLDQVRQYTSQTLGLHYTPLTQADFAKIAAS
QSK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttttgaaatacctcgcggtattccttgttgttcttttaattgcagcgatc
gccttcctctttaggcctattgcttctaaaaaaattcaaacctctgccaatgagcctgta
gtcgatgttgttctggtaggtggcggtatcatgagtgccacgctgggaacgtatttgact
gaacttgagccaaactggcaaattcggatgtatgaacgccttgaccgcgttgctcaagaa
agctcaaatggttttaataatgcaggtactggccactcaggctttatggaaatgaactat
accgaagaaaaagacggtaaaatggacatttctaaagctgtgaaagttgctgaacagttt
gaaatttcaaaacagttctgggcataccaagtcaaacacaatgtacttggtcaaccatca
agttttatcaacccagtgccgcatcatgcatttgtatggggtgataatgttgcatttctt
gaaaaacgttatgcagcgatgattaaaaatccactgttttatggtatgcaatttactgag
aatgcaaaccagattaaacaatgggcgcctctcaccatggaaggccgtgatcctgcacag
aaagttgcagcaacacgtatggaaattggttctgatgtaaactacggtgcaatcaccact
caattggtgaataacctagataaacatcaaaatttcaaactttcaacttcaagtgaagtt
actggcattagtcaaaacgatgacaaaacctggacagttgctttcaagaacttaaaaaca
ggcaaagcggatcatgtgaaaacacgttttgtgtttattggtgcaggcggtgcaagtgtc
aaacttttacagatgaccggtttacctgaatctaagcagtatgcaggcttcccagtgggc
ggtgtgttcttgatgactgacaatcctaaaattgcagcagaacacacagcaaaactatat
ggccgcgccgagctaggtgcgccgccaatgtctgtacctcacattgatactcgttatatc
gatggtaagaaatatgttttatttggaccatttgcaacctattcaaacaagttcctgaaa
caaggctctcagtttgatttgttggcatcaaccaataaaaacaacgtgttaccaatgact
gctgttggtatggaaaatcttgatttggtgaaatatttagttagccaagtgatgatgacc
gatgaagatcgtttcaatgagttgaaaaagtactacccaaatgcgaaacgtgaagactgg
cgtttgaaccaaggtggccagcgtgttcaggtcatcaaaaaagaagaaggcaaaccagcc
aaacttcaatttggtacagaagtatttgtttctaaagaccgttcagttactgcactgatg
ggtgcatctcctggcgcgtctacttcaccatacattatgttgaatttgcttgaaaaagct
ttcccacaacaagtgaaaggtgaatggaatccaaagctgcacgaaatcgtaagatcgtac
aaacaagatttaagtgataatcctgtacttcttgatcaagtgcgtcagtacaccagccaa
acacttggcctgcactacacaccattgactcaagctgatttcgccaagattgctgcaagt
cagtctaaataa

DBGET integrated database retrieval system