KEGG   Acinetobacter sp. ADP1: ACIAD1689Help
Entry
ACIAD1689         CDS       T00185                                 

Gene name
dcaF
Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00071  Fatty acid degradation
aci00072  Synthesis and degradation of ketone bodies
aci00280  Valine, leucine and isoleucine degradation
aci00310  Lysine degradation
aci00362  Benzoate degradation
aci00380  Tryptophan metabolism
aci00620  Pyruvate metabolism
aci00630  Glyoxylate and dicarboxylate metabolism
aci00640  Propanoate metabolism
aci00650  Butanoate metabolism
aci00900  Terpenoid backbone biosynthesis
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01120  Microbial metabolism in diverse environments
aci01130  Biosynthesis of antibiotics
aci01200  Carbon metabolism
aci01212  Fatty acid metabolism
aci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACIAD1689 (dcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    ACIAD1689 (dcaF)
   00640 Propanoate metabolism
    ACIAD1689 (dcaF)
   00650 Butanoate metabolism
    ACIAD1689 (dcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACIAD1689 (dcaF)
   00072 Synthesis and degradation of ketone bodies
    ACIAD1689 (dcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACIAD1689 (dcaF)
   00310 Lysine degradation
    ACIAD1689 (dcaF)
   00380 Tryptophan metabolism
    ACIAD1689 (dcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACIAD1689 (dcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACIAD1689 (dcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACIAD1689 (dcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aci04147]
    ACIAD1689 (dcaF)
Enzymes [BR:aci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACIAD1689 (dcaF)
Exosome [BR:aci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACIAD1689 (dcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: CAG68532
UniProt: Q6FBN0
Position
complement(1693338..1694543)
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRTPFGRHAGELASIRPDDLAGLVIQRLIEKTGVAGADIEDVIFGDTNQAG
EDSRNIARHAALLAGLPVTVPGQTVNRLCASGLAAIIDSARAITCGEGDLYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGTRFPNKKIVAQYGGHSMPETGDNVAVEYGISREQA
DLFAAQSQAKYQKALEEGFFAGEITAVEVSQGKKLPPKQVTEDEHPRPSSTLEALSKLKP
LFEGGVVTAGNASGINDGAAALLIGSEVAGQKYGLTPMAKILSAAAAGVEPRIMGAGPIE
AIKKAVARAGLTLDDLDIIEINEAFASQVLSCLKGLGIDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELQRRNKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatttatgatggtttacgtacgccatttggtcgccatgcaggtgaa
cttgcttcaatccgtcccgatgaccttgcaggattagtgattcaacgcttgattgaaaaa
acaggtgtagcaggtgcagacattgaagatgtgatttttggtgataccaatcaggcaggt
gaagacagtcgaaatatagcccgtcatgctgcattattggcaggtttgcctgtgactgta
ccgggccagactgtaaaccgattatgtgccagtggcttagctgcaattattgattctgct
cgtgcaatcacatgcggtgagggtgatttatatattgcgggtggtgttgagagtatgtca
cgcgcaccatttgtcatgggtaaagctgaaagtgcctatagccgagatgcaaaaatttat
gataccaccattggtacacgttttcctaataagaaaattgtagcccaatacggcggtcat
tcaatgcctgaaacaggtgataatgtcgcggttgaatatggcattagccgtgaacaagcc
gatttatttgctgcgcaatcacaggcaaaatatcagaaagcactcgaagaaggttttttt
gctggcgaaattacagcagtagaagtgtctcaaggaaaaaaattaccccctaagcaagtg
actgaagatgaacatccgcgtccgagctccacgcttgaggctttaagcaaattaaagcca
ttatttgaaggtggtgtggtgactgctggcaatgcttcgggtatcaatgacggtgcagct
gcgttattaattggttcagaagttgctggtcaaaaatatggtttaacccccatggcaaaa
atattgtctgcggcagcggctggtgttgaaccacgcattatgggtgcagggccaatcgaa
gcaattaaaaaagctgttgcgcgtgcaggtttgacactagatgatttagacattattgaa
attaatgaagcttttgcctcacaagttttgtcttgcctaaaaggtttaggtatcgatttt
aacgacccacgtgttaatccaaatggtggtgctattgcagtgggtcaccctctaggtgca
tcgggtgcgcgtttggcactgacagtagcgcgtgaattacaacgtcgcaataaaaaatat
gcagttgtcagcttgtgtattggtgttggtcaaggtttagcaatggtcattgaaaacgtt
tcataa

DBGET integrated database retrieval system