KEGG   Acinetobacter sp. ADP1: ACIAD2087Help
Entry
ACIAD2087         CDS       T00185                                 

Definition
(GenBank) putative PLP-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aci  Acinetobacter sp. ADP1
Pathway
aci00220  Arginine biosynthesis
aci00250  Alanine, aspartate and glutamate metabolism
aci00290  Valine, leucine and isoleucine biosynthesis
aci01100  Metabolic pathways
aci01110  Biosynthesis of secondary metabolites
aci01130  Biosynthesis of antibiotics
aci01210  2-Oxocarboxylic acid metabolism
aci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACIAD2087
   00290 Valine, leucine and isoleucine biosynthesis
    ACIAD2087
   00220 Arginine biosynthesis
    ACIAD2087
Enzymes [BR:aci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ACIAD2087
    2.6.1.66  valine---pyruvate transaminase
     ACIAD2087
Amino acid related enzymes [BR:aci01007]
 Aminotransferase (transaminase)
  Class I
   ACIAD2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase MerR-DNA-bind CBM_20
Motif
Other DBs
NCBI-ProteinID: CAG68896
UniProt: Q6FAL7
Position
2069321..2070751
Genome map
AA seq 476 aa AA seqDB search
MSQKKSVIFKNLLPVIKQYQQAGFTHEKIVALLKDQHDLDLVTTETFKSYLYRYAKVTPT
PSESLKMTNTIQTPREIKKSSKLEHVCYDIRGPVLRAANEMEEQGHKIIKLNIGNPAPFG
FEAPQEIINDVALNLPNAIGYTDSKGIFPARKAICQYYQQKGIRDMHVNDVYVGNGVSEL
IVMAMQGLLNDGDEMLVPMPDYPLWTAAVNLSGGTAIHYKCDEENSWYPDIVDMESKITP
NTRGIVVINPNNPTGSVYPRHVLQQIVALAKKHDLILFADEIYDKIIYDGIEHVALASLA
GDQLCISFNGLSKSYRVAGYRSGWMAITGDKSRAKDYIEGLDMLASMRLCANHQAQYAIQ
TALGGYQSINDLIRPSGRLYEQRNIAWEMLNEIHGVSCVKPEGAMYCFPKLDPNIYQVED
DEQLMLDFLRAEKVLLVQGTGFNWPTHDHFRLVFLPAENELREAITRLSRFLATRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaaaaaagcgttatttttaaaaacctactccctgtgattaaacaatatcaa
caggctggattcacgcatgaaaaaattgttgctttactcaaagaccaacatgatcttgat
cttgtaacaactgaaacatttaaaagctatttatatcgttatgcaaaagtgacccccact
ccatccgagagcctcaaaatgacgaacacaattcaaaccccacgagaaattaaaaaatct
tctaagctcgagcatgtatgctacgacattcgtggacctgtgttacgagcggccaatgaa
atggaagaacaaggtcataaaattattaaacttaatattggcaaccctgcgccatttggt
ttcgaagcacctcaagaaattattaatgatgtcgcattaaatctacctaacgcgattggt
tacactgactccaaaggtatcttccctgcacgtaaagccatttgccagtattatcagcaa
aaaggtattcgcgatatgcacgtcaatgatgtgtatgttggaaacggggtatccgaactg
attgtcatggccatgcaaggtttgctaaatgatggcgatgaaatgctggttccaatgcca
gattatccactctggacagcagcagtaaatttatctggtggtacagcaattcactataaa
tgtgatgaagaaaatagctggtatccagatattgtcgatatggaaagcaaaataacgcct
aatactcgtggtattgtggtgattaatccaaataatccaacaggttcggtttatccaaga
cacgtgctccagcaaattgtagctttagctaaaaagcacgatctgattttatttgccgat
gaaatctatgacaagattatttacgatggaattgaacacgtagcacttgcctctcttgca
ggcgatcaactctgtatttcctttaatggtttatcaaaatcttatcgtgttgcaggttat
cgttcaggctggatggcgattacaggtgataaatcacgtgctaaagattacatcgaaggt
ctggatatgctggcatccatgcgcctatgtgccaaccatcaagcacaatatgcgattcaa
acggctttaggcggttatcagtcgattaatgacttgattcgtccaagcggacgtttatac
gagcaacgcaatattgcatgggaaatgcttaatgaaatacacggcgtcagttgtgtaaaa
cctgagggtgccatgtattgctttccaaaactagatccgaatatttatcaggtcgaggat
gatgaacagttgatgctggatttcttacgtgcagagaaagtgcttctggtacaaggaaca
ggatttaactggccaacgcatgatcacttccgcttggtcttcttaccagcagagaatgag
cttcgagaagcaattacacgattatcacgctttctcgcaacgcgccgttaa

DBGET integrated database retrieval system