KEGG   Acinetobacter baylyi: ACIAD2513Help
Entry
ACIAD2513         CDS       T00185                                 

Gene name
atoD
Definition
(GenBank) acetoacetyl-CoA transferase, alpha subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
aci  Acinetobacter baylyi
Pathway
aci00072  Synthesis and degradation of ketone bodies
aci00280  Valine, leucine and isoleucine degradation
aci00650  Butanoate metabolism
aci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACIAD2513 (atoD)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ACIAD2513 (atoD)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACIAD2513 (atoD)
Enzymes [BR:aci01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     ACIAD2513 (atoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: CAG69280
UniProt: Q6F9I4
Position
2468252..2468956
Genome map
AA seq 234 aa AA seqDB search
MDKVYKSAALALQDIVKDHQTLAVGGFGLCGIPEALIGALKDTQVKHLTCISNNAGVDDF
GLGLLLQTKQIKKMISSYVGENKEFERQYLNGELEVELTPQGTLAEKLRAGGAGIPAFYT
QTGVGTLIAEGKEQREFDGKTYILEPSLTADIALVKAYKADRAGNLVFRKTARNFNPECA
MAGKITVAEVEQIVETGELDPDEIHLAGIFVHRVVLNSAPEKRIEQKTLKAQGA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtatataaaagtgcagcgctcgcactacaggatattgttaaagatcatcaa
accttggcagtaggcggtttcgggctttgtggtattcccgaagcgttaattggtgcattg
aaagatacacaagtcaaacatctgacctgtatttccaacaacgctggcgtggatgatttt
ggtttaggtttgttattgcaaaccaaacaaatcaagaaaatgatctcttcttatgtagga
gagaataaggaatttgaacgccaatatctcaatggcgagcttgaagttgaattgacacct
caaggtacgttggccgaaaagctgcgtgctggtggtgcaggcatccctgctttttacacg
caaacaggtgtaggaactcttattgccgaaggcaaggagcaacgagaatttgatgggaaa
acctatattttagaaccctccttaactgctgatattgcattggtgaaagcttataaagca
gacagagcaggcaatctggtgtttcgtaaaaccgcgcgtaattttaaccctgaatgtgct
atggctggaaaaattaccgttgccgaagttgagcagatcgttgaaacaggcgaacttgat
ccagatgaaattcacttagcaggtatttttgtacatcgcgttgtgctcaatagtgcacca
gaaaaacgtatcgaacaaaaaactttaaaagcacagggagcataa

DBGET integrated database retrieval system