KEGG   Acinetobacter baylyi: ACIAD2686
Entry
ACIAD2686         CDS       T00185                                 

Definition
(GenBank) conserved hypothetical protein; putative secretion system (EvpG)
  KO
K11895  type VI secretion system protein ImpH
Organism
aci  Acinetobacter baylyi
Brite
KEGG Orthology (KO) [BR:aci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aci02044]
    ACIAD2686
Secretion system [BR:aci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACIAD2686
SSDB
Motif
Pfam: T6SS_TssG PS_Dcarbxylase
Other DBs
NCBI-ProteinID: CAG69440
UniProt: Q6F925
Position
complement(2643220..2644218)
AA seq 332 aa
MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK
TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT
VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN
TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG
KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV
HQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcgtacagaacgttggtggcaagacacttctgtaaccgatcatttgtttcggcaattt
ggcagatttgagtttattcaggcaacacgattattacgtcatgtaccttatcacatggat
caaactcagtgggccagtgagttccaatttggttcctctttagcacttagttttcccaag
actgaaatcgagcatcttgctcaaagcgatgagcggattgagatgactagtctagtagtc
ggtttaactggaacacaaggggctttgccttatacctataccaataaactcaagcaaagt
tcacgtcagcaacgccgtgagattcaggcatttttaggtctgtttaatcacactttaact
gtacagtatgtcgatgctagtttggttcatcatctacctgtacgttatgaggtagagcaa
gaaaatcattatttaaatattttacatgccttgaatggatatatttcatcacatcatcag
cacaacgaattagatgagtattttgctgaatttgcaggactaatgcagggacaaaataat
actgcacatgccttaactacaatgttgacatgtatttttaagcaaaaagtgatggttaaa
gagtttattcgagaaaaattttatttaagtgacgaacaaaaaacctgtttgggaggggca
caacccagtttgcttggtatcaatactttttgtggcgatacaattgaacagattgatgga
aaaattgaaattcagattggccctttaaaacgtaaacaatacttagactttttaccgagt
gggcgcgcgagtacacagcttaagcatattttagcaacatggtgtagtcccactttactg
gtcgatctacgcttaattctggatcaggatgatgtacaacctttttgtctggattcagtc
catcaaatgggattgggacagggtgtttttctgacttctcaggcttccaatcaggataat
caagatacgtgttattcgctgataggagccgtagcatga

DBGET integrated database retrieval system