KEGG   Acinetobacter baylyi: ACIAD2689Help
Entry
ACIAD2689         CDS       T00185                                 

Definition
(GenBank) conserved hypothetical protein; putative secretion system (EvpC)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
aci  Acinetobacter baylyi
Pathway
aci03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ACIAD2689
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aci02044]
    ACIAD2689
Secretion system [BR:aci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACIAD2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DUF3880
Motif
Other DBs
NCBI-ProteinID: CAG69443
UniProt: Q6F922
Position
complement(2646545..2647048)
Genome map
AA seq 167 aa AA seqDB search
MKDIYVQFRGKYKVDGESRDSEHKDWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDM
LFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNE
EGVPTEVFGLKYAAVEWTYNQQDINGSAKGAVTKKWSLSNNTASYAA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatatacgttcaatttcgaggtaaatataaggttgatggtgagtcacgtgat
tctgagcacaaagactggcttgaagtcaactcgtggtcgcataatattcgccagccaaaa
tctgcaacttcaagtagcgtaggtggtcacactgctgaacgtgttgagcattcagatatg
ctttttgttaaagatttggatgcaaccagccctaaactgtgggaagcatgctctgcaggt
tatacctttgatgaagtacagatcgatttttatcgtgccaatggtgataaacgtatcaag
taccttcaaatcaaactcaaacatgttttagtttcaagtgtaactccgactgtaaatgaa
gagggtgtacctactgaagtgtttggtttgaaatatgctgcagttgagtggacttataac
cagcaagacattaacggttctgctaaaggtgctgtgactaaaaaatggtctctttcaaat
aacactgcatcttacgctgcgtaa

DBGET integrated database retrieval system